Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)

Mouse anti-Human POU2F3 Monoclonal Antibody | anti-POU2F3 antibody

POU2F3 (POU Domain, Class 2, Transcription Factor 3, Octamer-binding Protein 11, Oct-11, Octamer-binding Transcription Factor 11, OTF-11, Transcription Factor PLA-1, Transcription Factor Skn-1, OTF11, PLA1) (Biotin)

Gene Names
POU2F3; PLA1; OCT11; PLA-1; Epoc-1; OCT-11; OTF-11; Skn-1a
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
POU2F3; Monoclonal Antibody; POU2F3 (POU Domain; Class 2; Transcription Factor 3; Octamer-binding Protein 11; Oct-11; Octamer-binding Transcription Factor 11; OTF-11; Transcription Factor PLA-1; Transcription Factor Skn-1; OTF11; PLA1) (Biotin); anti-POU2F3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6D1
Specificity
Recognizes human POU2F3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-POU2F3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human POU2F3 (NP_055167) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQ*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.1kD).)
Related Product Information for anti-POU2F3 antibody
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Regulated the expression of a number of genes such as SPRR2A or placental lactogen.
Product Categories/Family for anti-POU2F3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
POU domain, class 2, transcription factor 3 isoform 1
NCBI Official Synonym Full Names
POU class 2 homeobox 3
NCBI Official Symbol
POU2F3
NCBI Official Synonym Symbols
PLA1; OCT11; PLA-1; Epoc-1; OCT-11; OTF-11; Skn-1a
NCBI Protein Information
POU domain, class 2, transcription factor 3
UniProt Protein Name
POU domain, class 2, transcription factor 3
UniProt Gene Name
POU2F3
UniProt Synonym Gene Names
OTF11; PLA1; Oct-11; OTF-11
UniProt Entry Name
PO2F3_HUMAN

NCBI Description

This gene encodes a member of the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways. The encoded protein is primarily expressed in the epidermis, and plays a critical role in keratinocyte proliferation and differentiation. The encoded protein is also a candidate tumor suppressor protein, and aberrant promoter methylation of this gene may play a role in cervical cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

Oct11: Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Regulated the expression of a number of genes such as SPRR2A or placental lactogen. Belongs to the POU transcription factor family. Class- 2 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 11q23.3

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; nucleus

Molecular Function: protein dimerization activity; protein binding; sequence-specific DNA binding

Biological Process: keratinocyte differentiation; regulation of transcription from RNA polymerase II promoter; epidermis development; transcription, DNA-dependent; wound healing; positive regulation of transcription from RNA polymerase II promoter

Research Articles on POU2F3

Similar Products

Product Notes

The POU2F3 pou2f3 (Catalog #AAA6143674) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The POU2F3 (POU Domain, Class 2, Transcription Factor 3, Octamer-binding Protein 11, Oct-11, Octamer-binding Transcription Factor 11, OTF-11, Transcription Factor PLA-1, Transcription Factor Skn-1, OTF11, PLA1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's POU2F3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the POU2F3 pou2f3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "POU2F3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.