Mouse anti-Human OCA2 Monoclonal Antibody | anti-OCA2 antibody

OCA2 (P Protein, Melanocyte-specific Transporter Protein, Pink-eyed Dilution Protein Homolog, D15S12, P) (Biotin)

Cat. Num. AAA6143301

• Gene Names: OCA2; P; BEY; PED; BEY1; BEY2; BOCA; EYCL; HCL3; EYCL2; EYCL3; SHEP1; D15S12
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: OCA2; Monoclonal Antibody; OCA2 (P Protein; Melanocyte-specific Transporter Protein; Pink-eyed Dilution Protein Homolog; D15S12; P) (Biotin); anti-OCA2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1A11
• Specificity: Recognizes human OCA2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 3082

• Applicable Applications for anti-OCA2 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa201-300 from human OCA2 (AAH12097) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADALGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETV
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Related Product Information for anti-OCA2 antibody

Could be involved in the transport of tyrosine, the precursor to melanin synthesis, within the melanocyte. Regulates the pH of melanosome and the melanosome maturation. One of the components of the mammalian pigmentary system. Seems to regulate the post-translational processing of tyrosinase, which catalyzes the limiting reaction in melanin synthesis. May serve as a key control point at which ethnic skin color variation is determined. Major determinant of brown and/or blue eye color.

Product Categories/Family for anti-OCA2 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 15082368
• NCBI GeneID: 4948
• NCBI Official Full Name: Homo sapiens oculocutaneous albinism II, mRNA
• NCBI Official Synonym Full Names: OCA2 melanosomal transmembrane protein
• NCBI Official Symbol: OCA2
• NCBI Official Synonym Symbols: P; BEY; PED; BEY1; BEY2; BOCA; EYCL; HCL3; EYCL2; EYCL3; SHEP1; D15S12
• NCBI Protein Information: P protein
• Protein Family: P protein

NCBI Description

This gene encodes the human homolog of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine, which is a precursor to melanin synthesis. It is involved in mammalian pigmentation, where it may control skin color variation and act as a determinant of brown or blue eye color. Mutations in this gene result in type 2 oculocutaneous albinism. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]