Mouse anti-Human FKBP1A Monoclonal Antibody | anti-FKBP1A antibody

FKBP1A (Peptidyl-prolyl cis-trans Isomerase FKBP1A, PPIase FKBP1A, FK506-binding Protein 1A, FKBP-1A, Rotamase, Immunophilin FKBP12, 12kD FKBP, 12kD FK506-binding Protein, FKBP-12, FKBP1, FKBP12) (Biotin)

Cat. Num. AAA6141914

• Gene Names: FKBP1A; FKBP1; PKC12; PKCI2; FKBP12; PPIASE; FKBP-12; FKBP-1A
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FKBP1A; Monoclonal Antibody; FKBP1A (Peptidyl-prolyl cis-trans Isomerase FKBP1A; PPIase FKBP1A; FK506-binding Protein 1A; FKBP-1A; Rotamase; Immunophilin FKBP12; 12kD FKBP; 12kD FK506-binding Protein; FKBP-12; FKBP1; FKBP12) (Biotin); anti-FKBP1A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1E5-A12
• Specificity: Recognizes human FKBP1A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-FKBP1A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant protein corresponding to aa1-108 from human FKBP1A with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.62kD).)

Western Blot (WB)

(Western Blot analysis of FKBP1A expression in HL-60 using 126829.)

Western Blot (WB)

(Western Blot analysis of FKBP1A expression in transfected 293T cell line by 126829. Lane 1: FKBP1A transfected lysate (12kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged FKBP1A is 3ng/ml using 126829 as a capture antibody.)

Related Product Information for anti-FKBP1A antibody

FKBP12 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium.

Product Categories/Family for anti-FKBP1A antibody

Antibodies; Enzymes; Isomerase

References

1. Protein-protein interactions: an application of tus-ter mediated protein microarray system. Sitaraman K, Chatterjee DK.Methods Mol Biol. 2011;723:185-200.

NCBI and Uniprot Product Information

• NCBI GI #: 37588948
• NCBI GeneID: 2280
• Molecular Weight: 11,951 Da
• NCBI Official Full Name: Homo sapiens FK506 binding protein 1A, 12kDa, mRNA
• NCBI Official Synonym Full Names: FK506 binding protein 1A
• NCBI Official Symbol: FKBP1A
• NCBI Official Synonym Symbols: FKBP1; PKC12; PKCI2; FKBP12; PPIASE; FKBP-12; FKBP-1A
• NCBI Protein Information: peptidyl-prolyl cis-trans isomerase FKBP1A
• Protein Family: Peptidyl-prolyl cis-trans isomerase

NCBI Description

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. [provided by RefSeq, Sep 2008]