Mouse anti-Human ERCC1 Monoclonal Antibody | anti-ERCC1 antibody

ERCC1 (DNA Excision Repair Protein ERCC-1) (Biotin)

Cat. Num. AAA6141767

• Gene Names: ERCC1; UV20; COFS4; RAD10
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ERCC1; Monoclonal Antibody; ERCC1 (DNA Excision Repair Protein ERCC-1) (Biotin); anti-ERCC1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A7
• Specificity: Recognizes human ERCC1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-ERCC1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa207-281 from human ERCC1 (AAH52813) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.99kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ERCC1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ERCC1 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-ERCC1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 31127247
• NCBI GeneID: 2067
• Molecular Weight: 25,211 Da
• NCBI Official Full Name: Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence), mRNA
• NCBI Official Synonym Full Names: ERCC excision repair 1, endonuclease non-catalytic subunit
• NCBI Official Symbol: ERCC1
• NCBI Official Synonym Symbols: UV20; COFS4; RAD10
• NCBI Protein Information: DNA excision repair protein ERCC-1
• Protein Family: DNA excision repair protein

NCBI Description

The product of this gene functions in the nucleotide excision repair pathway, and is required for the repair of DNA lesions such as those induced by UV light or formed by electrophilic compounds including cisplatin. The encoded protein forms a heterodimer with the XPF endonuclease (also known as ERCC4), and the heterodimeric endonuclease catalyzes the 5' incision in the process of excising the DNA lesion. The heterodimeric endonuclease is also involved in recombinational DNA repair and in the repair of inter-strand crosslinks. Mutations in this gene result in cerebrooculofacioskeletal syndrome, and polymorphisms that alter expression of this gene may play a role in carcinogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. The last exon of this gene overlaps with the CD3e molecule, epsilon associated protein gene on the opposite strand. [provided by RefSeq, Oct 2009]