Mouse anti-Human B3GALT2 Monoclonal Antibody | anti-B3GALT2 antibody

B3GALT2 (Beta-1,3-galactosyltransferase 2, UDP-galactose:2-acetamido-2-deoxy-D-glucose 3beta-galactosyltransferase 2) (Biotin)

Cat. Num. AAA6140765

• Gene Names: B3GALT2; GLCT2; BETA3GALT2; beta3Gal-T2
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: B3GALT2; Monoclonal Antibody; B3GALT2 (Beta-1; 3-galactosyltransferase 2; UDP-galactose:2-acetamido-2-deoxy-D-glucose 3beta-galactosyltransferase 2) (Biotin); anti-B3GALT2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A6
• Specificity: Recognizes human B3GALT2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 422

• Applicable Applications for anti-B3GALT2 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa324-422 from B3GALT2 (NP_003774) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AEKIFKVSLGIRRLHLEDVYVGICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRKLH
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged B3GALT2 is ~3ng/ml as a capture antibody.)

Product Categories/Family for anti-B3GALT2 antibody

Antibodies; Enzymes; Glycosyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 4502339
• NCBI GeneID: 8707
• NCBI Accession #: NP_003774
• NCBI GenBank Nucleotide #: NM_003783
• UniProt Accession #: O43825
• NCBI Official Full Name: beta-1,3-galactosyltransferase 2
• NCBI Official Synonym Full Names: beta-1,3-galactosyltransferase 2
• NCBI Official Symbol: B3GALT2
• NCBI Official Synonym Symbols: GLCT2; BETA3GALT2; beta3Gal-T2
• NCBI Protein Information: beta-1,3-galactosyltransferase 2
• UniProt Protein Name: Beta-1,3-galactosyltransferase 2
• Protein Family: Beta-1,3-galactosyltransferase
• UniProt Gene Name: B3GALT2
• UniProt Entry Name: B3GT2_HUMAN

NCBI Description

This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. This family encodes type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon. The beta3GalT proteins also contain conserved sequences not found in the beta4GalT or alpha3GalT proteins. The carbohydrate chains synthesized by these enzymes are designated as type 1, whereas beta4GalT enzymes synthesize type 2 carbohydrate chains. The ratio of type 1:type 2 chains changes during embryogenesis. By sequence similarity, the beta3GalT genes fall into at least two groups: beta3GalT4 and 4 other beta3GalT genes (beta3GalT1-3, beta3GalT5). This gene encodes a protein that functions in N-linked glycoprotein glycosylation and shows strict donor substrate specificity for UDP-galactose. [provided by RefSeq, Jul 2008]

Uniprot Description

B3GALT2: Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-N- acetylglucosamine (beta-GlcNAc) residue. Can also utilize substrates with a terminal galactose residue, albeit with lower efficiency. Involved in the biosynthesis of the carbohydrate moieties of glycolipids and glycoproteins. Inactive towards substrates with terminal alpha-N-acetylglucosamine (alpha-GlcNAc) or alpha-N-acetylgalactosamine (alpha-GalNAc) residues. Belongs to the glycosyltransferase 31 family.

Protein type: EC 2.4.1.-; Glycan Metabolism - glycosphingolipid biosynthesis - lacto and neolacto series; Transferase; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q31

Cellular Component: Golgi membrane; integral to membrane

Molecular Function: UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity

Biological Process: oligosaccharide biosynthetic process; protein amino acid glycosylation