Western Blot (WB)
(UBE2Q2 monoclonal antibody, Western Blot analysis of UBE2Q2 expression in A-431.)
Mouse anti-Human UBE2Q2 Monoclonal Antibody | anti-UBE2Q2 antibody
UBE2Q2 (Ubiquitin-conjugating Enzyme E2 Q2, Ubiquitin Carrier Protein Q2, Ubiquitin-protein Ligase Q2) APC
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBE2Q2; Monoclonal Antibody; UBE2Q2 (Ubiquitin-conjugating Enzyme E2 Q2; Ubiquitin Carrier Protein Q2; Ubiquitin-protein Ligase Q2) APC; EC=6.3.2.19; anti-UBE2Q2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H3
Specificity
Recognizes human UBE2Q2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-UBE2Q2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-111 from human UBE2Q2 (NP_775740) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLY
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(UBE2Q2 monoclonal antibody, Western Blot analysis of UBE2Q2 expression in A-431.)
Western Blot (WB)
(UBE2Q2 monoclonal antibody, Western Blot analysis of UBE2Q2 expression in A-431.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to UBE2Q2 on A-431 cell. [antibody concentration 10ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to UBE2Q2 on A-431 cell. [antibody concentration 10ug/ml].)
Testing Data
(Detection limit for recombinant GST tagged UBE2Q2 is ~1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged UBE2Q2 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-UBE2Q2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45.2kDa (398aa) confirmed by MALDI-TOF
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 Q2 isoform 1
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 Q2
NCBI Official Symbol
UBE2Q2
NCBI Protein Information
ubiquitin-conjugating enzyme E2 Q2
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 Q2
Protein Family
UniProt Gene Name
UBE2Q2
UniProt Entry Name
UB2Q2_HUMAN
Uniprot Description
UBE2Q2: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys- 48'-linked polyubiquitination. Belongs to the ubiquitin-conjugating enzyme family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: EC 6.3.2.19; Ligase; Ubiquitin conjugating system; Ubiquitin ligase
Chromosomal Location of Human Ortholog: 15q24.2
Molecular Function: ubiquitin-protein ligase activity
Research Articles on UBE2Q2
Similar Products
Product Notes
The UBE2Q2 ube2q2 (Catalog #AAA6139730) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBE2Q2 (Ubiquitin-conjugating Enzyme E2 Q2, Ubiquitin Carrier Protein Q2, Ubiquitin-protein Ligase Q2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2Q2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBE2Q2 ube2q2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBE2Q2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
