Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PPP2R5C expression in transfected 293T cell line by PPP2R5C monoclonal antibody. Lane 1: PPP2R5C transfected lysate (61.1kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human PPP2R5C Monoclonal Antibody | anti-PPP2R5C antibody

PPP2R5C (KIAA0044, Serine/Threonine-protein Phosphatase 2A 56kD Regulatory Subunit gamma Isoform, PP2A B Subunit Isoform B'-gamma, PP2A B Subunit Isoform B56-gamma, PP2A B Subunit Isoform PR61-gamma, PP2A B Subunit Isoform R5-gamma, Renal Carcinoma Antige

Gene Names
PPP2R5C; B56G; PR61G; MGC23064; PPP2R5C
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPP2R5C; Monoclonal Antibody; PPP2R5C (KIAA0044; Serine/Threonine-protein Phosphatase 2A 56kD Regulatory Subunit gamma Isoform; PP2A B Subunit Isoform B'-gamma; PP2A B Subunit Isoform B56-gamma; PP2A B Subunit Isoform PR61-gamma; PP2A B Subunit Isoform R5-gamma; Renal Carcinoma Antige; anti-PPP2R5C antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G9
Specificity
Recognizes human PPP2R5C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PPP2R5C antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human PPP2R5C (NP_002710.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFA
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PPP2R5C expression in transfected 293T cell line by PPP2R5C monoclonal antibody. Lane 1: PPP2R5C transfected lysate (61.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PPP2R5C expression in transfected 293T cell line by PPP2R5C monoclonal antibody. Lane 1: PPP2R5C transfected lysate (61.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged PPP2R5C is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PPP2R5C is ~3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between TP53 and PPP2R5C HeLa cells were stained with TP53 rabbit purified polyclonal 1:1200 and PPP2R5C mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Testing Data (Proximity Ligation Analysis of protein-protein interactions between TP53 and PPP2R5C HeLa cells were stained with TP53 rabbit purified polyclonal 1:1200 and PPP2R5C mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)
Related Product Information for anti-PPP2R5C antibody
The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-PPP2R5C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform isoform a [Homo sapiens]
NCBI Official Synonym Full Names
protein phosphatase 2, regulatory subunit B', gamma
NCBI Official Symbol
PPP2R5C
NCBI Official Synonym Symbols
B56G; PR61G; MGC23064; PPP2R5C
UniProt Protein Name
Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
UniProt Gene Name
PPP2R5C
UniProt Synonym Gene Names
KIAA0044
UniProt Entry Name
2A5G_HUMAN

Similar Products

Product Notes

The PPP2R5C ppp2r5c (Catalog #AAA6138407) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PPP2R5C (KIAA0044, Serine/Threonine-protein Phosphatase 2A 56kD Regulatory Subunit gamma Isoform, PP2A B Subunit Isoform B'-gamma, PP2A B Subunit Isoform B56-gamma, PP2A B Subunit Isoform PR61-gamma, PP2A B Subunit Isoform R5-gamma, Renal Carcinoma Antige reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP2R5C can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPP2R5C ppp2r5c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPP2R5C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.