Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.85kD).)

Mouse anti-Human MLKL Monoclonal Antibody | anti-MLKL antibody

MLKL (Mixed Lineage Kinase Domain-like Protein, FLJ34389) APC

Gene Names
MLKL; hMLKL
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MLKL; Monoclonal Antibody; MLKL (Mixed Lineage Kinase Domain-like Protein; FLJ34389) APC; anti-MLKL antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B2
Specificity
Recognizes human MLKL.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-MLKL antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa371-471 from human MLKL (NM_152649, NP_689862) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.85kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.85kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of MLKL on formalin-fixed paraffin-embedded human colon using 129722 (3ug/ml).)

Immunohistochemistry (IHC) (Immunoperoxidase of MLKL on formalin-fixed paraffin-embedded human colon using 129722 (3ug/ml).)

Testing Data

(Detection limit for recombinant GST tagged MLKL is 0.3ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged MLKL is 0.3ng/ml as a capture antibody)

Immunofluorescence (IF)

(Immunofluorescence on HeLa cells using 129722 (10ug/ml).)

Immunofluorescence (IF) (Immunofluorescence on HeLa cells using 129722 (10ug/ml).)
Product Categories/Family for anti-MLKL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
mixed lineage kinase domain-like protein isoform 1
NCBI Official Synonym Full Names
mixed lineage kinase domain like pseudokinase
NCBI Official Symbol
MLKL
NCBI Official Synonym Symbols
hMLKL
NCBI Protein Information
mixed lineage kinase domain-like protein
UniProt Protein Name
Mixed lineage kinase domain-like protein
UniProt Gene Name
MLKL
UniProt Entry Name
MLKL_HUMAN

NCBI Description

This gene belongs to the protein kinase superfamily. The encoded protein contains a protein kinase-like domain; however, is thought to be inactive because it lacks several residues required for activity. This protein plays a critical role in tumor necrosis factor (TNF)-induced necroptosis, a programmed cell death process, via interaction with receptor-interacting protein 3 (RIP3), which is a key signaling molecule in necroptosis pathway. Inhibitor studies and knockdown of this gene inhibited TNF-induced necrosis. High levels of this protein and RIP3 are associated with inflammatory bowel disease in children. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

MLKL: Belongs to the protein kinase superfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, protein; Protein kinase, TKL; Protein kinase, Ser/Thr (non-receptor); TKL group; TKL-Unique family

Chromosomal Location of Human Ortholog: 16q23.1

Cellular Component: cytoplasm; plasma membrane

Molecular Function: protein binding; protein complex binding; protein kinase binding; ATP binding; protein kinase activity

Biological Process: protein amino acid phosphorylation

Research Articles on MLKL

Similar Products

Product Notes

The MLKL mlkl (Catalog #AAA6137638) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MLKL (Mixed Lineage Kinase Domain-like Protein, FLJ34389) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MLKL can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MLKL mlkl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MLKL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.