Western Blot (WB)
(Western Blot detection against Immunogen (35.79kD).)
Mouse anti-Human LYPLA2 Monoclonal Antibody | anti-LYPLA2 antibody
LYPLA2 (APT2, Acyl-protein Thioesterase 2, APT-2, Lysophospholipase II, LPL-II, LysoPLA II) APC
Gene Names
LYPLA2; APT2; APT-2; DJ886K2.4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LYPLA2; Monoclonal Antibody; LYPLA2 (APT2; Acyl-protein Thioesterase 2; APT-2; Lysophospholipase II; LPL-II; LysoPLA II) APC; anti-LYPLA2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3H5
Specificity
Recognizes human LYPLA2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-LYPLA2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa144-232 from LYPLA2 (NP_009191) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (35.79kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (35.79kD).)
Related Product Information for anti-LYPLA2 antibody
Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq].
Product Categories/Family for anti-LYPLA2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26.9 kDa (251aa), confirmed by MALDI-TOF
NCBI Official Full Name
acyl-protein thioesterase 2
NCBI Official Synonym Full Names
lysophospholipase II
NCBI Official Symbol
LYPLA2
NCBI Official Synonym Symbols
APT2; APT-2; DJ886K2.4
NCBI Protein Information
acyl-protein thioesterase 2
UniProt Protein Name
Acyl-protein thioesterase 2
Protein Family
UniProt Gene Name
LYPLA2
UniProt Synonym Gene Names
APT2; APT-2; LPL-II; LysoPLA II
UniProt Entry Name
LYPA2_HUMAN
NCBI Description
Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq, Jul 2008]
Uniprot Description
LYPLA2: May hydrolyze fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has lysophospholipase activity. Deacylates GAP43. Belongs to the AB hydrolase 2 family.
Protein type: EC 3.1.2.-; Phospholipase; Lipid Metabolism - glycerophospholipid
Chromosomal Location of Human Ortholog: 1p36.11
Cellular Component: cytoplasm
Molecular Function: hydrolase activity
Biological Process: fatty acid metabolic process
Research Articles on LYPLA2
Similar Products
Product Notes
The LYPLA2 lypla2 (Catalog #AAA6137469) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LYPLA2 (APT2, Acyl-protein Thioesterase 2, APT-2, Lysophospholipase II, LPL-II, LysoPLA II) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LYPLA2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LYPLA2 lypla2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LYPLA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
