Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human LIMD1 Monoclonal Antibody | anti-LIMD1 antibody

LIMD1 (LIM Domain-containing Protein 1) APC

Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LIMD1; Monoclonal Antibody; LIMD1 (LIM Domain-containing Protein 1) APC; anti-LIMD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2G5
Specificity
Recognizes human LIMD1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
11442
Applicable Applications for anti-LIMD1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa577-675 from LIMD1 (NP_055055.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VDSENKIYCVRDYHKVLAPKCAACGLPILPPEGSDETIRVVSMDRDYHVECYHCEDCGLELNDEDGHRCYPLEDHLFCHSCHVKRLEKRPSSTALHQH
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(Western Blot analysis of LIMD1 expression in transfected 293T cell line by LIMD1 monoclonal antibody Lane 1: LIMD1 transfected lysate (Predicted MW: 72.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LIMD1 expression in transfected 293T cell line by LIMD1 monoclonal antibody Lane 1: LIMD1 transfected lysate (Predicted MW: 72.2kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LIMD1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to LIMD1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged LIMD1 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LIMD1 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-LIMD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens LIM domains containing 1 (LIMD1), mRNA
NCBI Official Synonym Full Names
LIM domains containing 1
NCBI Official Symbol
LIMD1
NCBI Protein Information
LIM domain-containing protein 1
UniProt Protein Name
LIM domain-containing protein 1
UniProt Gene Name
LIMD1
UniProt Entry Name
LIMD1_HUMAN

Uniprot Description

LIMD1: Adapter or scaffold protein which participates in the assembly of numerous protein complexes and is involved in several cellular processes such as cell fate determination, cytoskeletal organization, repression of gene transcription, cell-cell adhesion, cell differentiation, proliferation and migration. Positively regulates microRNA (miRNA)-mediated gene silencing and is essential for P-body formation and integrity. Acts as a hypoxic regulator by bridging an association between the prolyl hydroxylases and VHL enabling efficient degradation of HIF1A. Acts as a transcriptional corepressor for SNAI1- and SNAI2/SLUG- dependent repression of E-cadherin transcription. Negatively regulates the Hippo signaling pathway and antagonizes phosphorylation of YAP1. Inhibits E2F-mediated transcription, and suppresses the expression of the majority of genes with E2F1- responsive elements. Regulates osteoblast development, function, differentiation and stress osteoclastogenesis. Enhances the ability of TRAF6 to activate adapter protein complex 1 (AP-1) and negatively regulates the canonical Wnt receptor signaling pathway in osteoblasts. May act as a tumor suppressor by inhibiting cell proliferation. Belongs to the zyxin/ajuba family.

Protein type: Tumor suppressor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: adherens junction; focal adhesion; cytoplasm; nucleus

Molecular Function: protein binding; zinc ion binding; transcription corepressor activity

Biological Process: cell migration; transcription, DNA-dependent; multicellular organismal development; cytoskeleton organization and biogenesis; signal transduction; miRNA-mediated gene silencing; osteoblast development; regulation of cell shape; regulation of transcription, DNA-dependent; response to hypoxia; cytoplasmic mRNA processing body assembly; negative regulation of osteoblast differentiation; negative regulation of transcription, DNA-dependent; phosphorylation

Research Articles on LIMD1

Similar Products

Product Notes

The LIMD1 limd1 (Catalog #AAA6137408) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LIMD1 (LIM Domain-containing Protein 1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LIMD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LIMD1 limd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LIMD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.