Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of LAP3 expression in transfected 293T cell line by LAP3 monoclonal antibody. Lane 1: LAP3 transfected lysate (56.2kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human LAP3 Monoclonal Antibody | anti-LAP3 antibody

LAP3 (Cytosol Aminopeptidase, Leucine Aminopeptidase 3, LAP-3, Leucyl Aminopeptidase, Peptidase S, Proline Aminopeptidase, Prolyl Aminopeptidase, LAPEP, PEPS) APC

Gene Names
LAP3; LAP; PEPS; LAPEP; HEL-S-106
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LAP3; Monoclonal Antibody; LAP3 (Cytosol Aminopeptidase; Leucine Aminopeptidase 3; LAP-3; Leucyl Aminopeptidase; Peptidase S; Proline Aminopeptidase; Prolyl Aminopeptidase; LAPEP; PEPS) APC; anti-LAP3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G10
Specificity
Recognizes human LAP3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-LAP3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa420-520 from human LAP3 (NP_056991) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LAP3 expression in transfected 293T cell line by LAP3 monoclonal antibody. Lane 1: LAP3 transfected lysate (56.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LAP3 expression in transfected 293T cell line by LAP3 monoclonal antibody. Lane 1: LAP3 transfected lysate (56.2kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged LAP3 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LAP3 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-LAP3 antibody
Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.
Product Categories/Family for anti-LAP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58.3kDa (539aa)
NCBI Official Full Name
cytosol aminopeptidase
NCBI Official Synonym Full Names
leucine aminopeptidase 3
NCBI Official Symbol
LAP3
NCBI Official Synonym Symbols
LAP; PEPS; LAPEP; HEL-S-106
NCBI Protein Information
cytosol aminopeptidase
UniProt Protein Name
Cytosol aminopeptidase
Protein Family
UniProt Gene Name
LAP3
UniProt Synonym Gene Names
LAPEP; PEPS; LAP-3
UniProt Entry Name
AMPL_HUMAN

Research Articles on LAP3

Similar Products

Product Notes

The LAP3 lap3 (Catalog #AAA6137363) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LAP3 (Cytosol Aminopeptidase, Leucine Aminopeptidase 3, LAP-3, Leucyl Aminopeptidase, Peptidase S, Proline Aminopeptidase, Prolyl Aminopeptidase, LAPEP, PEPS) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LAP3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LAP3 lap3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LAP3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.