Western Blot (WB)
(Western Blot detection against Immunogen (34.36kD).)
Mouse anti-Human EIF3A Monoclonal Antibody | anti-EIF3A antibody
EIF3A (EIF3S10, KIAA0139, Eukaryotic Translation Initiation Factor 3 Subunit A, Eukaryotic Translation Initiation Factor 3 Subunit 10, eIF-3-theta, eIF3 p167, eIF3 p180, eIF3 p185) APC
Gene Names
EIF3A; EIF3; P167; p180; p185; TIF32; EIF3S10; eIF3-p170; eIF3-theta
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EIF3A; Monoclonal Antibody; EIF3A (EIF3S10; KIAA0139; Eukaryotic Translation Initiation Factor 3 Subunit A; Eukaryotic Translation Initiation Factor 3 Subunit 10; eIF-3-theta; eIF3 p167; eIF3 p180; eIF3 p185) APC; anti-EIF3A antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G4
Specificity
Recognizes human EIF3A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-EIF3A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-76 from EIF3A (NP_003741) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (34.36kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (34.36kD).)
Western Blot (WB)
(EIF3A monoclonal antibody Western Blot analysis of EIF3A expression in HepG2.)
Western Blot (WB)
(EIF3A monoclonal antibody Western Blot analysis of EIF3A expression in HepG2.)
Product Categories/Family for anti-EIF3A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
162,636 Da
NCBI Official Full Name
eukaryotic translation initiation factor 3 subunit A
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 3, subunit A
NCBI Official Symbol
EIF3A
NCBI Official Synonym Symbols
EIF3; P167; p180; p185; TIF32; EIF3S10; eIF3-p170; eIF3-theta
NCBI Protein Information
eukaryotic translation initiation factor 3 subunit A; EIF3, p180 subunit; EIF3A; centrosomin homolog; cytoplasmic protein p167; eIF-3-theta; eIF3 p167; eIF3 p180; eIF3 p185; eukaryotic translation initiation factor 3 subunit 10; eukaryotic translation ini
UniProt Protein Name
Eukaryotic translation initiation factor 3 subunit A
Protein Family
UniProt Gene Name
EIF3A
UniProt Synonym Gene Names
EIF3S10; KIAA0139; eIF3a
UniProt Entry Name
EIF3A_HUMAN
Similar Products
Product Notes
The EIF3A eif3a (Catalog #AAA6136388) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EIF3A (EIF3S10, KIAA0139, Eukaryotic Translation Initiation Factor 3 Subunit A, Eukaryotic Translation Initiation Factor 3 Subunit 10, eIF-3-theta, eIF3 p167, eIF3 p180, eIF3 p185) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EIF3A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EIF3A eif3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EIF3A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
