Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human, Rat CACNG3 Monoclonal Antibody | anti-CACNG3 antibody

CACNG3 (Voltage-dependent Calcium Channel gamma-3 Subunit, Neuronal Voltage-gated Calcium Channel gamma-3 Subunit, Transmembrane AMPAR Regulatory Protein gamma-3) APC

Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CACNG3; Monoclonal Antibody; CACNG3 (Voltage-dependent Calcium Channel gamma-3 Subunit; Neuronal Voltage-gated Calcium Channel gamma-3 Subunit; Transmembrane AMPAR Regulatory Protein gamma-3) APC; anti-CACNG3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3E4
Specificity
Recognizes human CACNG3. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
315
Applicable Applications for anti-CACNG3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa199-297 from CACNG3 (NP_006530) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(CACNG3 monoclonal antibody Western Blot analysis of CACNG3 expression in HeLa.)

Western Blot (WB) (CACNG3 monoclonal antibody Western Blot analysis of CACNG3 expression in HeLa.)

Western Blot (WB)

(CACNG3 monoclonal antibody Western Blot analysis of CACNG3 expression in PC-12.)

Western Blot (WB) (CACNG3 monoclonal antibody Western Blot analysis of CACNG3 expression in PC-12.)

Western Blot (WB)

(Western Blot analysis of CACNG3 expression in transfected 293T cell line by CACNG3 monoclonal antibody. Lane 1: CACNG3 transfected lysate (35.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CACNG3 expression in transfected 293T cell line by CACNG3 monoclonal antibody. Lane 1: CACNG3 transfected lysate (35.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged CACNG3 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CACNG3 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-CACNG3 antibody
The protein encoded by this gene is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family. This gene is a susceptibility locus for childhood absence epilepsy.
Product Categories/Family for anti-CACNG3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
voltage-dependent calcium channel gamma-3 subunit
NCBI Official Synonym Full Names
calcium voltage-gated channel auxiliary subunit gamma 3
NCBI Official Symbol
CACNG3
NCBI Protein Information
voltage-dependent calcium channel gamma-3 subunit
UniProt Protein Name
Voltage-dependent calcium channel gamma-3 subunit
UniProt Gene Name
CACNG3
UniProt Synonym Gene Names
TARP gamma-3
UniProt Entry Name
CCG3_HUMAN

NCBI Description

The protein encoded by this gene is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family. This gene is a susceptibility locus for childhood absence epilepsy. [provided by RefSeq, Dec 2010]

Uniprot Description

Function: Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization. Does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. Thought to stabilize the calcium channel in an inactivated (closed) state

By similarity.

Subunit structure: The L-type calcium channel is composed of five subunits: alpha-1, alpha-2/delta, beta and gamma. Acts as an auxiliary subunit for AMPA-selective glutamate receptors (AMPARs). Found in a complex with GRIA1, GRIA2, GRIA3, GRIA4, CNIH2, CNIH3, CACNG2, CACNG4, CACNG5, CACNG7 and CACNG8

By similarity.

Subcellular location: Membrane; Multi-pass membrane protein.

Sequence similarities: Belongs to the PMP-22/EMP/MP20 family. CACNG subfamily.

Research Articles on CACNG3

Similar Products

Product Notes

The CACNG3 cacng3 (Catalog #AAA6135621) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CACNG3 (Voltage-dependent Calcium Channel gamma-3 Subunit, Neuronal Voltage-gated Calcium Channel gamma-3 Subunit, Transmembrane AMPAR Regulatory Protein gamma-3) APC reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CACNG3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CACNG3 cacng3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CACNG3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.