Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human EPHB3 Monoclonal Antibody | anti-EPHB3 antibody

EPHB3 (EPH Receptor B3, EPH-like Tyrosine Kinase-2, Ephrin Receptor EphB3, Human Embryo Kinase 2, ETK2, HEK2, TYRO6) (AP)

Gene Names
EPHB3; EK2; ETK2; HEK2; TYRO6
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
EPHB3; Monoclonal Antibody; EPHB3 (EPH Receptor B3; EPH-like Tyrosine Kinase-2; Ephrin Receptor EphB3; Human Embryo Kinase 2; ETK2; HEK2; TYRO6) (AP); anti-EPHB3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G8
Specificity
Recognizes human EPHB3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-EPHB3 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa899-997 from human EPHB3 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQ
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-EPHB3 antibody
Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members.
Product Categories/Family for anti-EPHB3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107kDa
NCBI Official Full Name
ephrin type-B receptor 3
NCBI Official Synonym Full Names
EPH receptor B3
NCBI Official Symbol
EPHB3
NCBI Official Synonym Symbols
EK2; ETK2; HEK2; TYRO6
NCBI Protein Information
ephrin type-B receptor 3
UniProt Protein Name
Ephrin type-B receptor 3
Protein Family
UniProt Gene Name
EPHB3
UniProt Synonym Gene Names
ETK2; HEK2; TYRO6; EPH-like kinase 2; EK2; hEK2
UniProt Entry Name
EPHB3_HUMAN

NCBI Description

Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into two groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. This gene encodes a receptor for ephrin-B family members. [provided by RefSeq, Mar 2010]

Uniprot Description

EphB3: a ubiquitous receptor tyrosine kinase of the Eph family. A receptor for ephrin-B family members: ephrin-B1 and -B2. The Eph receptor tyrosine kinase family, the largest in the tyrosine kinase group, has fourteen members. They bind membrane-anchored ligands, ephrins, at sites of cell-cell contact, regulating the repulsion and adhesion of cells that underlie the establishment, maintenance, and remodeling of patterns of cellular organization. Eph signals are particularly important in regulating cell adhesion and cell migration during development, axon guidance, homeostasis and disease. EphA receptors bind to GPI-anchored ephrin-A ligands, while EphB receptors bind to ephrin-B proteins that have a transmembrane and cytoplasmic domain. Interactions between EphB receptor kinases and ephrin-B proteins transduce signals bidirectionally, signaling to both interacting cell types. Eph receptors and ephrins also regulate the adhesion of endothelial cells and are required for the remodeling of blood vessels.EphB3 contains 1 sterile alpha motif (SAM) domain and 2 fibronectin type III domains.

Protein type: EC 2.7.10.1; Protein kinase, TK; Kinase, protein; Membrane protein, integral; Protein kinase, tyrosine (receptor); TK group; Eph family

Chromosomal Location of Human Ortholog: 3q27.1

Cellular Component: integral to plasma membrane; dendrite; plasma membrane; extracellular region; cytosol

Molecular Function: ephrin receptor activity; axon guidance receptor activity; ATP binding

Biological Process: axon guidance; cell migration; peptidyl-tyrosine phosphorylation; thymus development; protein amino acid autophosphorylation; axonal fasciculation; central nervous system projection neuron axonogenesis; digestive tract morphogenesis; palate development; regulation of axonogenesis; corpus callosum development; positive regulation of synaptogenesis; regulation of cell-cell adhesion; ephrin receptor signaling pathway; angiogenesis; urogenital system development; retinal ganglion cell axon guidance

Research Articles on EPHB3

Similar Products

Product Notes

The EPHB3 ephb3 (Catalog #AAA6134779) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EPHB3 (EPH Receptor B3, EPH-like Tyrosine Kinase-2, Ephrin Receptor EphB3, Human Embryo Kinase 2, ETK2, HEK2, TYRO6) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EPHB3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EPHB3 ephb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EPHB3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.