Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged VDAC3 is 1ng/ml as a capture antibody.)

Mouse anti-Human VDAC3 Monoclonal Antibody | anti-VDAC3 antibody

VDAC3 (Voltage-dependent Anion-selective Channel Protein 3, VDAC-3, hVDAC3, Outer Mitochondrial Membrane Protein Porin 3) (AP)

Gene Names
VDAC3; VDAC-3; HD-VDAC3
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
VDAC3; Monoclonal Antibody; VDAC3 (Voltage-dependent Anion-selective Channel Protein 3; VDAC-3; hVDAC3; Outer Mitochondrial Membrane Protein Porin 3) (AP); anti-VDAC3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C6
Specificity
Recognizes human VDAC3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-VDAC3 antibody
ELISA (EIA)
Application Notes
ELISA: 1ng/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-283 from human VDAC3 (AAH56870) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTHVNDGTEFGGSIYQKVNEKIETSINLAWTAGSNNTRFGIAAKYMLDCRTSLSAKVNNASLIGLGYTQTLRPGVKLTLSALIDGKNFSAGGHKVGLGFELEA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged VDAC3 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged VDAC3 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-VDAC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
30,790 Da
NCBI Official Full Name
Homo sapiens voltage-dependent anion channel 3, mRNA
NCBI Official Synonym Full Names
voltage dependent anion channel 3
NCBI Official Symbol
VDAC3
NCBI Official Synonym Symbols
VDAC-3; HD-VDAC3
NCBI Protein Information
voltage-dependent anion-selective channel protein 3

NCBI Description

This gene encodes a voltage-dependent anion channel (VDAC), and belongs to the mitochondrial porin family. VDACs are small, integral membrane proteins that traverse the outer mitochondrial membrane and conduct ATP and other small metabolites. They are known to bind several kinases of intermediary metabolism, thought to be involved in translocation of adenine nucleotides, and are hypothesized to form part of the mitochondrial permeability transition pore, which results in the release of cytochrome c at the onset of apoptotic cell death. Alternatively transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2011]

Research Articles on VDAC3

Similar Products

Product Notes

The VDAC3 (Catalog #AAA6134526) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The VDAC3 (Voltage-dependent Anion-selective Channel Protein 3, VDAC-3, hVDAC3, Outer Mitochondrial Membrane Protein Porin 3) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VDAC3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). ELISA: 1ng/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the VDAC3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "VDAC3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.