Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of UMPS expression in transfected 293T cell line by UMPS monoclonal antibody. Lane 1: UMPS transfected lysate (52.2kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human Uridine 5'-monophosphate Synthase Monoclonal Antibody | anti-UMPS antibody

Uridine 5'-monophosphate Synthase (UMP Synthase, UMPS, OK/SW-cl.21) (AP)

Gene Names
UMPS; OPRT
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Uridine 5'-monophosphate Synthase; Monoclonal Antibody; Uridine 5'-monophosphate Synthase (UMP Synthase; UMPS; OK/SW-cl.21) (AP); Orotate Phosphoribosyltransferase; OPRT; OPRTase; EC=2.4.2.10; Orotidine 5'-phosphate Decarboxylase; ODC; OMPdecase; EC=4.1.1.23; anti-UMPS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2F5
Specificity
Recognizes human UMPS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-UMPS antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa381-479 from human UMPS (NP_000364) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of UMPS expression in transfected 293T cell line by UMPS monoclonal antibody. Lane 1: UMPS transfected lysate (52.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of UMPS expression in transfected 293T cell line by UMPS monoclonal antibody. Lane 1: UMPS transfected lysate (52.2kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to UMPS on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to UMPS on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged UMPS is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UMPS is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-UMPS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54.3 kDa (500aa)
NCBI Official Full Name
uridine 5'-monophosphate synthase
NCBI Official Synonym Full Names
uridine monophosphate synthetase
NCBI Official Symbol
UMPS
NCBI Official Synonym Symbols
OPRT
NCBI Protein Information
uridine 5'-monophosphate synthase
UniProt Protein Name
Uridine 5'-monophosphate synthase
UniProt Gene Name
UMPS
UniProt Synonym Gene Names
UMP synthase; OPRT; OPRTase; ODC
UniProt Entry Name
UMPS_HUMAN

NCBI Description

This gene encodes a uridine 5'-monophosphate synthase. The encoded protein is a bifunctional enzyme that catalyzes the final two steps of the de novo pyrimidine biosynthetic pathway. The first reaction is carried out by the N-terminal enzyme orotate phosphoribosyltransferase which converts orotic acid to orotidine-5'-monophosphate. The terminal reaction is carried out by the C-terminal enzyme OMP decarboxylase which converts orotidine-5'-monophosphate to uridine monophosphate. Defects in this gene are the cause of hereditary orotic aciduria. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

Uniprot Description

UMPS: Defects in UMPS are the cause of orotic aciduria type 1 (ORAC1). A disorder of pyrimidine metabolism resulting in megaloblastic anemia and orotic acid crystalluria that is frequently associated with some degree of physical and mental retardation. A minority of cases have additional features, particularly congenital malformations and immune deficiencies. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 4.1.1.23; Transferase; Xenobiotic Metabolism - drug metabolism - other enzymes; Nucleotide Metabolism - pyrimidine; EC 2.4.2.10; Lyase

Chromosomal Location of Human Ortholog: 3q13

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: orotate phosphoribosyltransferase activity; orotidine-5'-phosphate decarboxylase activity

Biological Process: lactation; 'de novo' pyrimidine base biosynthetic process; pyrimidine base metabolic process; nucleobase, nucleoside and nucleotide metabolic process; UMP biosynthetic process; pyrimidine nucleoside biosynthetic process; female pregnancy

Disease: Orotic Aciduria

Research Articles on UMPS

Similar Products

Product Notes

The UMPS umps (Catalog #AAA6134465) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Uridine 5'-monophosphate Synthase (UMP Synthase, UMPS, OK/SW-cl.21) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Uridine 5'-monophosphate Synthase can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UMPS umps for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Uridine 5'-monophosphate Synthase, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.