Mouse anti-Human SUPT4H1 Monoclonal Antibody | anti-SUPT4H1 antibody

SUPT4H1 (Transcription Elongation Factor SPT4, hSPT4, DRB Sensitivity-inducing Factor 14kD Subunit, DSIF p14, DRB Sensitivity-inducing Factor Small Subunit, DSIF Small Subunit, SPT4H, SUPT4H) (AP)

Cat. Num. AAA6134073

• Gene Names: SUPT4H1; SPT4; SPT4H; SUPT4H; Supt4a
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SUPT4H1; Monoclonal Antibody; SUPT4H1 (Transcription Elongation Factor SPT4; hSPT4; DRB Sensitivity-inducing Factor 14kD Subunit; DSIF p14; DRB Sensitivity-inducing Factor Small Subunit; DSIF Small Subunit; SPT4H; SUPT4H) (AP); anti-SUPT4H1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3G4
• Specificity: Recognizes human SUPT4H1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-SUPT4H1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa18-118 from human SUPT4H1 (NP_003159) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SUPT4H1 expression in transfected 293T cell line by SUPT4H1 monoclonal antibody. Lane 1: SUPT4H1 transfected lysate (13.193kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-SUPT4H1 antibody

Component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. DSIF positively regulates mRNA capping by stimulating the mRNA guanylyltransferase activity of RNGTT/CAP1A. DSIF also acts cooperatively with the negative elongation factor complex (NELF complex) to enhance transcriptional pausing at sites proximal to the promoter. Transcriptional pausing may facilitate the assembly of an elongation competent RNA polymerase II complex. DSIF and NELF promote pausing by inhibition of the transcription elongation factor TFIIS/S-II. TFIIS/S-II binds to RNA polymerase II at transcription pause sites and stimulates the weak intrinsic nuclease activity of the enzyme. Cleavage of blocked transcripts by RNA polymerase II promotes the resumption of transcription from the new 3' terminus and may allow repeated attempts at transcription through natural pause sites. DSIF can also positively regulate transcriptional elongation and is required for the efficient activation of transcriptional elongation by the HIV-1 nuclear transcriptional activator, Tat. DSIF acts to suppress transcriptional pausing in transcripts derived from the HIV-1 LTR and blocks premature release of HIV-1 transcripts at terminator sequences.

Product Categories/Family for anti-SUPT4H1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4507311
• NCBI GeneID: 6827
• NCBI Accession #: NP_003159
• NCBI GenBank Nucleotide #: NM_003168
• UniProt Accession #: P63272
• Molecular Weight: 13kDa
• NCBI Official Full Name: transcription elongation factor SPT4
• NCBI Official Synonym Full Names: SPT4 homolog, DSIF elongation factor subunit
• NCBI Official Symbol: SUPT4H1
• NCBI Official Synonym Symbols: SPT4; SPT4H; SUPT4H; Supt4a
• NCBI Protein Information: transcription elongation factor SPT4
• UniProt Protein Name: Transcription elongation factor SPT4
• UniProt Gene Name: SUPT4H1
• UniProt Synonym Gene Names: SPT4H; SUPT4H; hSPT4; DSIF p14; DSIF small subunit
• UniProt Entry Name: SPT4H_HUMAN

NCBI Description

This gene encodes the small subunit of DRB (5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole) sensitivity-inducing factor (DSIF) complex, which regulates mRNA processing and transcription elongation by RNA polymerase II. The encoded protein is localized to the nucleus and interacts with the large subunit (SUPT5H) to form the DSIF complex. Related pseudogenes have been identified on chromosomes 2 and 12. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2012]