Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human SLC20A2 Monoclonal Antibody | anti-SLC20A2 antibody

SLC20A2 (Sodium-dependent Phosphate Transporter 2, Gibbon Ape Leukemia Virus Receptor 2, GLVR-2, Phosphate Transporter 2, PiT-2, Pit2, hPit2, Solute Carrier Family 20 Member 2, GLVR2, PIT2) (AP)

Gene Names
SLC20A2; PIT2; RAM1; GLVR2; IBGC1; IBGC2; IBGC3; MLVAR; PIT-2; Ram-1; GLVR-2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC20A2; Monoclonal Antibody; SLC20A2 (Sodium-dependent Phosphate Transporter 2; Gibbon Ape Leukemia Virus Receptor 2; GLVR-2; Phosphate Transporter 2; PiT-2; Pit2; hPit2; Solute Carrier Family 20 Member 2; GLVR2; PIT2) (AP); anti-SLC20A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B1
Specificity
Recognizes human SLC20A2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
652
Applicable Applications for anti-SLC20A2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa243-343 from human SLC20A2 (NP_006740) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEGTSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGH*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Testing Data

(Detection limit for recombinant GST tagged SLC20A2 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC20A2 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-SLC20A2 antibody
Sodium-phosphate symporter which seems to play a fundamental housekeeping role in phosphate transport by absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. In vitro, sodium-dependent phosphate uptake is not siginificantly affected by acidic and alkaline conditions, however sodium-independent phosphate uptake occurs at acidic conditions. May play a role in extracellular matrix, cartilage and vascular calcification. Functions as a retroviral receptor and confers human cells susceptibility to infection to amphotropic murine leukemia virus (A-MuLV), 10A1 murine leukemia virus (10A1 MLV) and some feline leukemia virus subgroup B (FeLV-B) variants.
Product Categories/Family for anti-SLC20A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
sodium-dependent phosphate transporter 2
NCBI Official Synonym Full Names
solute carrier family 20 member 2
NCBI Official Symbol
SLC20A2
NCBI Official Synonym Symbols
PIT2; RAM1; GLVR2; IBGC1; IBGC2; IBGC3; MLVAR; PIT-2; Ram-1; GLVR-2
NCBI Protein Information
sodium-dependent phosphate transporter 2
UniProt Protein Name
Sodium-dependent phosphate transporter 2
UniProt Gene Name
SLC20A2
UniProt Synonym Gene Names
GLVR2; PIT2; GLVR-2; PiT-2; Pit2; hPit2
UniProt Entry Name
S20A2_HUMAN

NCBI Description

This gene encodes a member of the inorganic phosphate transporter family. The encoded protein is a type 3 sodium-dependent phosphate symporter that plays an important role in phosphate homeostasis by mediating cellular phosphate uptake. The encoded protein also confers susceptibility to viral infection as a gamma-retroviral receptor. Mutations in this gene may play a role in familial idiopathic basal ganglia calcification. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]

Uniprot Description

SLC20A2: Sodium-phosphate symporter which seems to play a fundamental housekeeping role in phosphate transport by absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. In vitro, sodium-dependent phosphate uptake is not siginificantly affected by acidic and alkaline conditions, however sodium-independent phosphate uptake occurs at acidic conditions. May play a role in extracellular matrix, cartilage and vascular calcification. Functions as a retroviral receptor and confers human cells susceptibility to infection to amphotropic murine leukemia virus (A-MuLV), 10A1 murine leukemia virus (10A1 MLV) and some feline leukemia virus subgroup B (FeLV-B) variants. Defects in SLC20A2 are the cause of basal ganglia calcification, idiopathic, type 3 (IBGC3). An autosomal dominant condition characterized by symmetric calcification in the basal ganglia and other brain regions. Affected individuals can either be asymptomatic or show a wide spectrum of neuropsychiatric symptoms, including parkinsonism, dystonia, tremor, ataxia, dementia, psychosis, seizures, and chronic headache. Serum levels of calcium, phosphate, alkaline phosphatase and parathyroid hormone are normal. Belongs to the inorganic phosphate transporter (PiT) (TC 2.A.20) family.

Protein type: Transporter, SLC family; Transporter; Membrane protein, multi-pass; Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 8p11.21

Cellular Component: membrane; integral to plasma membrane; plasma membrane

Molecular Function: viral receptor activity; receptor activity; sodium:phosphate symporter activity; inorganic phosphate transmembrane transporter activity

Biological Process: entry of virus into host cell; transport; ion transport; transmembrane transport

Disease: Basal Ganglia Calcification, Idiopathic, 1

Research Articles on SLC20A2

Similar Products

Product Notes

The SLC20A2 slc20a2 (Catalog #AAA6133791) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC20A2 (Sodium-dependent Phosphate Transporter 2, Gibbon Ape Leukemia Virus Receptor 2, GLVR-2, Phosphate Transporter 2, PiT-2, Pit2, hPit2, Solute Carrier Family 20 Member 2, GLVR2, PIT2) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC20A2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC20A2 slc20a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC20A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.