Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human SGK071 Monoclonal Antibody | anti-SGK071 antibody

SGK071 (Probable Inactive Protein Kinase-like Protein SgK071, Sugen Kinase 071, C9orf96, MGC43306) (AP)

Gene Names
STKLD1; Sk521; SgK071; C9orf96
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SGK071; Monoclonal Antibody; SGK071 (Probable Inactive Protein Kinase-like Protein SgK071; Sugen Kinase 071; C9orf96; MGC43306) (AP); anti-SGK071 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B5
Specificity
Recognizes human C9orf96.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SGK071 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-100 from human C9orf96 (NP_714921) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MLGPGSNRRRPTQGERGPGSPGEPMEKYQVLYQLNPGALGVNLVVEEMETKVKHVIKQVECMDDHYASQALEELMPLLKLRHAHISVYQELFITWNGEI
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of C9orf96 expression in transfected 293T cell line by C9orf96 monoclonal antibody. Lane 1: C9orf96 transfected lysate (75.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of C9orf96 expression in transfected 293T cell line by C9orf96 monoclonal antibody. Lane 1: C9orf96 transfected lysate (75.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged C9orf96 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged C9orf96 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of C9orf96 over-expressed 293 cell line, cotransfected with C9orf96 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with C9orf96 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of C9orf96 over-expressed 293 cell line, cotransfected with C9orf96 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with C9orf96 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-SGK071 antibody
C9orf96 belongs to the serine/threonine protein kinase family. However, the protein kinase domain is predicted to be catalytically inactive. The specific function of this protein is unknown.
Product Categories/Family for anti-SGK071 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,767 Da
NCBI Official Full Name
serine/threonine kinase-like domain-containing protein STKLD1
NCBI Official Synonym Full Names
serine/threonine kinase-like domain containing 1
NCBI Official Symbol
STKLD1
NCBI Official Synonym Symbols
Sk521; SgK071; C9orf96
NCBI Protein Information
serine/threonine kinase-like domain-containing protein STKLD1; probable inactive protein kinase-like protein SgK071; serine/threonine kinase-like domain-containing protein 1; sugen kinase 071
UniProt Protein Name
Serine/threonine kinase-like domain-containing protein STKLD1
UniProt Gene Name
STKLD1
UniProt Synonym Gene Names
C9orf96; SGK071
UniProt Entry Name
STKL1_HUMAN

Similar Products

Product Notes

The SGK071 stkld1 (Catalog #AAA6133718) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SGK071 (Probable Inactive Protein Kinase-like Protein SgK071, Sugen Kinase 071, C9orf96, MGC43306) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SGK071 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SGK071 stkld1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SGK071, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.