Mouse anti-Human RBM12 Monoclonal Antibody | anti-RBM12 antibody

RBM12 (KIAA0765, RNA-binding Protein 12, RNA-binding Motif Protein 12, SH3/WW Domain Anchor Protein in the Nucleus) (AP)

Cat. Num. AAA6133350

• Gene Names: RBM12; SWAN; SCZD19; HRIHFB2091
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RBM12; Monoclonal Antibody; RBM12 (KIAA0765; RNA-binding Protein 12; RNA-binding Motif Protein 12; SH3/WW Domain Anchor Protein in the Nucleus) (AP); anti-RBM12 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1D12
• Specificity: Recognizes human RBM12.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 6646

• Applicable Applications for anti-RBM12 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa834-932 from RBM12 (NP_006038) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GPGPIHIGGPPGFASSSGKPGPTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLG
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of RBM12 expression in transfected 293T cell line by RBM12 monoclonal antibody Lane 1: RBM12 transfected lysate (Predicted MW: 97.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged RBM12 is 0.03ng/ml as a capture antibody.)

Related Product Information for anti-RBM12 antibody

This gene encodes a protein that contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. This gene and the gene for copine I overlap at map location 20q11.21. Alternative splicing in the 5' UTR results in four transcript variants. All variants encode the same protein.

Product Categories/Family for anti-RBM12 antibody

Antibodies; RNA Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 1519313158
• NCBI GeneID: 10137
• NCBI Accession #: NM_006047.6
• NCBI GenBank Nucleotide #: NM_006047
• UniProt Accession #: Q9NTZ6
• NCBI Official Full Name: Homo sapiens RNA binding motif protein 12 (RBM12), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: RNA binding motif protein 12
• NCBI Official Symbol: RBM12
• NCBI Official Synonym Symbols: SWAN; SCZD19; HRIHFB2091
• NCBI Protein Information: RNA-binding protein 12
• UniProt Protein Name: RNA-binding protein 12
• Protein Family: RNA-binding protein
• UniProt Gene Name: RBM12
• UniProt Synonym Gene Names: KIAA0765
• UniProt Entry Name: RBM12_HUMAN

NCBI Description

This gene encodes a protein that contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. This gene and the gene for copine I overlap at map location 20q11.21. Alternative splicing in the 5' UTR results in four transcript variants. All variants encode the same protein. [provided by RefSeq, Nov 2010]