Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human Profilin 2 Monoclonal Antibody | anti-PFN2 antibody

Profilin 2 (Profilin-2, Profilin II, Profilin-II, PFN2, PFN-2, D3S1319E, PFL) (AP)

Gene Names
PFN2; PFL; D3S1319E
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Profilin 2; Monoclonal Antibody; Profilin 2 (Profilin-2; Profilin II; Profilin-II; PFN2; PFN-2; D3S1319E; PFL) (AP); anti-PFN2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5F11
Specificity
Recognizes human PFN2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PFN2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa41-141 from human PFN2 (NP_002619) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVHGGTLNKKAYELALYLRRSDV
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(PFN2 monoclonal antibody. Western Blot analysis of PFN2 expression in HeLa)

Western Blot (WB) (PFN2 monoclonal antibody. Western Blot analysis of PFN2 expression in HeLa)

Testing Data

(Detection limit for recombinant GST tagged PFN2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PFN2 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-PFN2 antibody
The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene. [provided by RefSeq]
Product Categories/Family for anti-PFN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,088 Da
NCBI Official Full Name
profilin-2 isoform b
NCBI Official Synonym Full Names
profilin 2
NCBI Official Symbol
PFN2
NCBI Official Synonym Symbols
PFL; D3S1319E
NCBI Protein Information
profilin-2; profilin II
UniProt Protein Name
Profilin-2
UniProt Gene Name
PFN2
UniProt Entry Name
PROF2_HUMAN

Uniprot Description

profilin 2: Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. Belongs to the profilin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Actin-binding

Chromosomal Location of Human Ortholog: 3q25.1

Cellular Component: cytoskeleton; cytoplasm; terminal button

Molecular Function: actin monomer binding; protein binding; phosphatidylinositol-4,5-bisphosphate binding; adenyl-nucleotide exchange factor activity

Biological Process: positive regulation of actin filament polymerization; positive regulation of ATPase activity; negative regulation of actin filament polymerization; positive regulation of stress fiber formation; positive regulation of actin filament bundle formation; actin cytoskeleton organization and biogenesis; positive regulation of peptidyl-serine phosphorylation

Similar Products

Product Notes

The PFN2 pfn2 (Catalog #AAA6133150) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Profilin 2 (Profilin-2, Profilin II, Profilin-II, PFN2, PFN-2, D3S1319E, PFL) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Profilin 2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PFN2 pfn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Profilin 2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.