Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (63.4kD).)

Mouse anti-Human, Mouse NDRG4 Monoclonal Antibody | anti-NDRG4 antibody

NDRG4 (BDM1, KIAA1180, Protein NDRG4, Brain Development-related Molecule 1, N-myc Downstream-regulated Gene 4 Protein, Vascular Smooth Muscle Cell-associated Protein 8, SMAP-8, DKFZp686I1615, FLJ30586, FLJ42011, MGC19632) (AP)

Gene Names
NDRG4; BDM1; SMAP8; SMAP-8
Reactivity
Human, Mouse
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NDRG4; Monoclonal Antibody; NDRG4 (BDM1; KIAA1180; Protein NDRG4; Brain Development-related Molecule 1; N-myc Downstream-regulated Gene 4 Protein; Vascular Smooth Muscle Cell-associated Protein 8; SMAP-8; DKFZp686I1615; FLJ30586; FLJ42011; MGC19632) (AP); anti-NDRG4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G3
Specificity
Recognizes human NDRG4. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-NDRG4 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-340 from human NDRG4 (AAH11795) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYMPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTMEVSC
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (63.4kD).)

Western Blot (WB) (Western Blot detection against Immunogen (63.4kD).)

Western Blot (WB)

(NDRG4 monoclonal antibody. Western Blot analysis of NDRG4 expression in Raw 264.7.)

Western Blot (WB) (NDRG4 monoclonal antibody. Western Blot analysis of NDRG4 expression in Raw 264.7.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to NDRG4 on formalin-fixed paraffin-embedded human colon adenocarcinoma. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to NDRG4 on formalin-fixed paraffin-embedded human colon adenocarcinoma. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged NDRG4 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NDRG4 is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-NDRG4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
39,168 Da
NCBI Official Full Name
Homo sapiens NDRG family member 4, mRNA
NCBI Official Synonym Full Names
NDRG family member 4
NCBI Official Symbol
NDRG4
NCBI Official Synonym Symbols
BDM1; SMAP8; SMAP-8
NCBI Protein Information
protein NDRG4
Protein Family

NCBI Description

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that is required for cell cycle progression and survival in primary astrocytes and may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Alternative splicing results in multiple transcripts encoding different isoforms.[provided by RefSeq, Jun 2011]

Research Articles on NDRG4

Similar Products

Product Notes

The NDRG4 (Catalog #AAA6132511) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NDRG4 (BDM1, KIAA1180, Protein NDRG4, Brain Development-related Molecule 1, N-myc Downstream-regulated Gene 4 Protein, Vascular Smooth Muscle Cell-associated Protein 8, SMAP-8, DKFZp686I1615, FLJ30586, FLJ42011, MGC19632) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NDRG4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NDRG4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NDRG4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.