Mouse anti-Human MS4A2 Monoclonal Antibody | anti-MS4A2 antibody

MS4A2 (High Affinity Immunoglobulin epsilon Receptor Subunit beta, FcERI, Fc epsilon Receptor I beta-chain, IgE Fc Receptor Subunit beta, Membrane-spanning 4-domains Subfamily A Member 2, APY, FCER1B, IGER) (AP)

Cat. Num. AAA6132390

• Gene Names: MS4A2; APY; IGEL; IGER; ATOPY; FCERI; IGHER; MS4A1; FCER1B
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MS4A2; Monoclonal Antibody; MS4A2 (High Affinity Immunoglobulin epsilon Receptor Subunit beta; FcERI; Fc epsilon Receptor I beta-chain; IgE Fc Receptor Subunit beta; Membrane-spanning 4-domains Subfamily A Member 2; APY; FCER1B; IGER) (AP); anti-MS4A2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B1
• Specificity: Recognizes human MS4A2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 244

• Applicable Applications for anti-MS4A2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-59 from human MS4A2 (NP_000130) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQE
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.23kD).)

Western Blot (WB)

(Western Blot analysis of MS4A2 expression in transfected 293T cell line by MS4A2 monoclonal antibody. Lane 1: MS4A2 transfected lysate (26.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged MS4A2 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-MS4A2 antibody

High affinity receptor that binds to the Fc region of immunoglobulins epsilon. Aggregation of FCER1 by multivalent antigens is required for the full mast cell response, including the release of preformed mediators (such as histamine) by degranulation and de novo production of lipid mediators and cytokines. Also mediates the secretion of important lymphokines. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators responsible for the manifestations of allergy.

Product Categories/Family for anti-MS4A2 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 4503677
• NCBI GeneID: 2206
• NCBI Accession #: NP_000130
• NCBI GenBank Nucleotide #: NM_000139
• UniProt Accession #: Q01362
• NCBI Official Full Name: high affinity immunoglobulin epsilon receptor subunit beta isoform 1
• NCBI Official Synonym Full Names: membrane spanning 4-domains A2
• NCBI Official Symbol: MS4A2
• NCBI Official Synonym Symbols: APY; IGEL; IGER; ATOPY; FCERI; IGHER; MS4A1; FCER1B
• NCBI Protein Information: high affinity immunoglobulin epsilon receptor subunit beta
• UniProt Protein Name: High affinity immunoglobulin epsilon receptor subunit beta
• Protein Family: High affinity immunoglobulin epsilon receptor
• UniProt Gene Name: MS4A2
• UniProt Synonym Gene Names: APY; FCER1B; IGER; FcERI
• UniProt Entry Name: FCERB_HUMAN

NCBI Description

The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-linked gamma chains, is found on the surface of mast cells and basophils. This gene encodes the beta subunit of the high affinity IgE receptor which is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member is localized to 11q12, among a cluster of membrane-spanning 4A gene family members. Alternative splicing results in multiple transcript variants encoding distinct proteins. Additional transcript variants have been described but require experimental validation. [provided by RefSeq, Mar 2012]