Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human DCBLD2 Monoclonal Antibody | anti-DCBLD2 antibody

DCBLD2 (CLCP1, ESDN, Discoidin, CUB and LCCL Domain-containing Protein 2, CUB, LCCL and Coagulation Factor V/VIII-homology Domains Protein 1, Endothelial and Smooth Muscle Cell-derived Neuropilin-like Protein) (AP)

Gene Names
DCBLD2; ESDN; CLCP1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DCBLD2; Monoclonal Antibody; DCBLD2 (CLCP1; ESDN; Discoidin; CUB and LCCL Domain-containing Protein 2; CUB; LCCL and Coagulation Factor V/VIII-homology Domains Protein 1; Endothelial and Smooth Muscle Cell-derived Neuropilin-like Protein) (AP); anti-DCBLD2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G10
Specificity
Recognizes human DCBLD2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-DCBLD2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa80-165 from human DCBLD2 (NP_563615) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-DCBLD2 antibody
DCBLD2, otherwise known as ESDN (endothelial and smooth muscle cell-derived neuropilin-like molecule) is a novel type-I transmembrane protein with the longest cleavable secretory signal sequence among eukaryotes. It is expressed in various tissues; particularly highly expressed in cultured vascular smooth muscle cells. DCBLD2 is considered to play a role in regulation of vascular cell growth and may have a wide variety of functions in other tissues including the nervous system, like neuropilins.
Product Categories/Family for anti-DCBLD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86,657 Da
NCBI Official Full Name
discoidin, CUB and LCCL domain-containing protein 2
NCBI Official Synonym Full Names
discoidin, CUB and LCCL domain containing 2
NCBI Official Symbol
DCBLD2
NCBI Official Synonym Symbols
ESDN; CLCP1
NCBI Protein Information
discoidin, CUB and LCCL domain-containing protein 2; 1700055P21Rik; coagulation factor V/VIII-homology domains protein 1; CUB, LCCL and coagulation factor V/VIII-homology domains protein 1; endothelial and smooth muscle cell-derived neuropilin-like protei
UniProt Protein Name
Discoidin, CUB and LCCL domain-containing protein 2
UniProt Gene Name
DCBLD2
UniProt Synonym Gene Names
CLCP1; ESDN
UniProt Entry Name
DCBD2_HUMAN

Uniprot Description

DCBLD2: a type-I transmembrane protein. May be involved in vascular remodeling and influence vascular smooth muscle cell proliferation. Contains a CUB domain and a coagulation factor V/VIII homology domain, similar to the structure of the neuropilins. Plays a role in cell motility. SEMA4B appears to be one of its ligands. Strongly expressed in nerve bundles. Highly expressed in testis, heart, skeletal muscle and also in cultured vascular smooth muscle cells. Increased in lung cancers during the process of tumor progression. A target of EGF signaling in the A431 cervical cancer cell-line. Two isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 3q12.1|3

Cellular Component: cell surface; integral to plasma membrane

Molecular Function: protein binding

Biological Process: intracellular receptor-mediated signaling pathway; wound healing; negative regulation of cell growth

Research Articles on DCBLD2

Similar Products

Product Notes

The DCBLD2 dcbld2 (Catalog #AAA6130872) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DCBLD2 (CLCP1, ESDN, Discoidin, CUB and LCCL Domain-containing Protein 2, CUB, LCCL and Coagulation Factor V/VIII-homology Domains Protein 1, Endothelial and Smooth Muscle Cell-derived Neuropilin-like Protein) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DCBLD2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DCBLD2 dcbld2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DCBLD2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.