Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CXCL12 is ~1ng/ml using 125501 as a capture antibody.)

Mouse anti-Human CXCL12 Monoclonal Antibody | anti-CXCL12 antibody

CXCL12 (SDF-1-alpha, Stromal Cell-derived Factor 1, hSDF-1, C-X-C Motif Chemokine 12, Intercrine Reduced in Hepatomas, IRH, hIRH, Pre-B Cell Growth-stimulating Factor, PBSF, SDF1, SDF1A) (AP)

Gene Names
CXCL12; IRH; PBSF; SDF1; TLSF; TPAR1; SCYB12
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CXCL12; Monoclonal Antibody; CXCL12 (SDF-1-alpha; Stromal Cell-derived Factor 1; hSDF-1; C-X-C Motif Chemokine 12; Intercrine Reduced in Hepatomas; IRH; hIRH; Pre-B Cell Growth-stimulating Factor; PBSF; SDF1; SDF1A) (AP); anti-CXCL12 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1E5
Specificity
Recognizes human CXCL12.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
1874
Applicable Applications for anti-CXCL12 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa1-89 from human CXCL12 (AAH39893) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CXCL12 is ~1ng/ml using 125501 as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CXCL12 is ~1ng/ml using 125501 as a capture antibody.)
Related Product Information for anti-CXCL12 antibody
CXCL12, also known as pre-B-cell growth-stimulating factor (PBSF) or stromal cell-derived factor-a (SDF-1a), is a 70aa CXC chemokine originally cloned from a bone marrow stromal cell line. Targeted deletion of CXCL12 gene resulted in defects of B-cell lymphopoiesis and bone marrow myelopoiesis. CXCL12 has been shown to be chemotactic for lymphocytes. In addition, CXCL12 was recently reported to be a ligand for CXCR4 (LESTR/fusin), a co-receptor for HIV-1 entry into T cells. CXCL12 binding to CXCR4 inhibits HIV-1 entry.
Product Categories/Family for anti-CXCL12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1), mRNA
NCBI Official Synonym Full Names
C-X-C motif chemokine ligand 12
NCBI Official Symbol
CXCL12
NCBI Official Synonym Symbols
IRH; PBSF; SDF1; TLSF; TPAR1; SCYB12
NCBI Protein Information
stromal cell-derived factor 1

NCBI Description

This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]

Research Articles on CXCL12

Similar Products

Product Notes

The CXCL12 (Catalog #AAA6130815) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CXCL12 (SDF-1-alpha, Stromal Cell-derived Factor 1, hSDF-1, C-X-C Motif Chemokine 12, Intercrine Reduced in Hepatomas, IRH, hIRH, Pre-B Cell Growth-stimulating Factor, PBSF, SDF1, SDF1A) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CXCL12 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CXCL12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CXCL12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.