Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.43kD).)

Mouse anti-Human APOC3 Monoclonal Antibody | anti-APOC3 antibody

APOC3 (Apolipoprotein C-III, Apo-CIII, ApoC-III, Apolipoprotein C3) (AP)

Gene Names
APOC3; HALP2; APOCIII
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
APOC3; Monoclonal Antibody; APOC3 (Apolipoprotein C-III; Apo-CIII; ApoC-III; Apolipoprotein C3) (AP); anti-APOC3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8H7
Specificity
Recognizes human APOC3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-APOC3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa21-99 from human APOC3 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.43kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.43kD).)

Testing Data

(Detection limit for recombinant GST tagged APOC3 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged APOC3 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-APOC3 antibody
Apolipoprotein C-III (Apo CIII) is one of 9 known polymorphic forms of apolipoproteins. The apolipoproteins functions as stabilizer of the intact lipoprotein particles. Specifically, Apo CIII is a very low density lipoprotein (VLDL) protein. Apo CIII is involved inhibition of lipoprotein lipase and hepatic lipase. It is thought to delay catabolism of triglyceride-rich particles. A defect in Apo CIII has been linked to cause of hyperalphalipoproteinemia (HLAP), which causes increase levels of high density lipoprotein (HDL).
Product Categories/Family for anti-APOC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
345
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,852 Da
NCBI Official Full Name
apolipoprotein C-III
NCBI Official Synonym Full Names
apolipoprotein C-III
NCBI Official Symbol
APOC3
NCBI Official Synonym Symbols
HALP2; APOCIII
NCBI Protein Information
apolipoprotein C-III; apo-CIII; apoC-III; apolipoprotein C3
UniProt Protein Name
Apolipoprotein C-III
Protein Family
UniProt Gene Name
APOC3
UniProt Synonym Gene Names
Apo-CIII; ApoC-III
UniProt Entry Name
APOC3_HUMAN

NCBI Description

Apolipoprotein C-III is a very low density lipoprotein (VLDL) protein. APOC3 inhibits lipoprotein lipase and hepatic lipase; it is thought to delay catabolism of triglyceride-rich particles. The APOA1, APOC3 and APOA4 genes are closely linked in both rat and human genomes. The A-I and A-IV genes are transcribed from the same strand, while the A-1 and C-III genes are convergently transcribed. An increase in apoC-III levels induces the development of hypertriglyceridemia. [provided by RefSeq, Jul 2008]

Uniprot Description

APOC3: Inhibits lipoprotein lipase and hepatic lipase and decreases the uptake of lymph chylomicrons by hepatic cells. This suggests that it delays the catabolism of triglyceride-rich particles. Defects in APOC3 are the cause of hyperalphalipoproteinemia type 2 (HALP2). HALP2 is a condition characterized by high levels of high density lipoprotein (HDL) and increased HDL cholesterol levels. Belongs to the apolipoprotein C3 family.

Protein type: Secreted; Secreted, signal peptide; Lipid-binding

Chromosomal Location of Human Ortholog: 11q23.3

Cellular Component: extracellular space; chylomicron; early endosome; extracellular region

Molecular Function: lipase inhibitor activity; cholesterol binding; phospholipid binding; enzyme regulator activity

Biological Process: response to drug; cholesterol metabolic process; response to peptide hormone stimulus; phototransduction, visible light; regulation of Cdc42 protein signal transduction; lipoprotein metabolic process; cholesterol efflux; G-protein coupled receptor protein signaling pathway; cholesterol homeostasis; triacylglycerol metabolic process; reverse cholesterol transport; negative regulation of lipid catabolic process; phospholipid efflux; lipoprotein transport; triacylglycerol catabolic process; negative regulation of lipoprotein lipase activity; negative regulation of receptor-mediated endocytosis; negative regulation of lipid metabolic process; retinoid metabolic process; inflammatory response; triacylglycerol mobilization; negative regulation of fatty acid biosynthetic process; response to nutrient

Disease: Apolipoprotein C-iii Deficiency

Research Articles on APOC3

Similar Products

Product Notes

The APOC3 apoc3 (Catalog #AAA6130029) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The APOC3 (Apolipoprotein C-III, Apo-CIII, ApoC-III, Apolipoprotein C3) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOC3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the APOC3 apoc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APOC3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.