Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PDS5, Regulator of Cohesion Maintenance, Homolog B Monoclonal Antibody | anti-PDS5B antibody

PDS5, Regulator of Cohesion Maintenance, Homolog B (PDS5B, APRIN, CG008, FLJ23236, KIAA0979, RP1-267P19.1)

Gene Names
PDS5B; AS3; APRIN; CG008; FLJ23236; KIAA0979; PDS5B
Reactivity
Human
Applications
Western Blot, Gel Super Shift Assay
Purity
Affinity Purified
Purified by Protein G affinity chromatography.
Synonyms
PDS5; Regulator of Cohesion Maintenance; Homolog B; Monoclonal Antibody; Homolog B (PDS5B; APRIN; CG008; FLJ23236; KIAA0979; RP1-267P19.1); Anti -PDS5; anti-PDS5B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1
Clone Number
8C261
Specificity
Recognizes human PDS5, Regulator of Cohesion Maintenance, Homolog B.
Purity/Purification
Affinity Purified
Purified by Protein G affinity chromatography.
Form/Format
Supplied as a sterile-filtered liquid in PBS, pH 7.4, 1% BSA, 0.05% sodium azide.
Applicable Applications for anti-PDS5B antibody
Western Blot (WB), Gel Shift Assay (GS/EMSA)
Application Notes
Suitable for use in Dot Blot and Western Blot.
Immunogen
Partial sequence of recombinant full-length protein to human PDS5, Regulator of Cohesion Maintenance, Homolog B consisting of amino acids from the C-terminal portion of the protein (Sequence: QWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKTSKKGSKKKSGPPAPEEEEEEERQSGNTEQKSKSKQHRVSRRAQQRAESPESSAIESTQSTPQKGRGRPSKTPSP)
Preparation and Storage
May be stored at 4 degree C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile glycerol (40-50), aliquot and store at -20 degree C. Aliquots are stable for at least 12 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Related Product Information for anti-PDS5B antibody
APRIN plays a role in androgen-induced proliferative arrest in prostate cells. It is required for maintenance of sister chromatid cohesion during mitosis.
Product Categories/Family for anti-PDS5B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
164,667 Da
NCBI Official Full Name
PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae)
NCBI Official Synonym Full Names
PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae)
NCBI Official Symbol
PDS5B
NCBI Official Synonym Symbols
AS3; APRIN; CG008; FLJ23236; KIAA0979; PDS5B
NCBI Protein Information
sister chromatid cohesion protein PDS5 homolog B; OTTHUMP00000197491; androgen-induced shutoff 3; androgen-induced proliferation inhibitor; androgen induced inhibitor of proliferation; androgen-induced prostate proliferative shutoff-associated protein AS3
UniProt Protein Name
Sister chromatid cohesion protein PDS5 homolog B
UniProt Gene Name
PDS5B
UniProt Synonym Gene Names
APRIN; AS3; KIAA0979
UniProt Entry Name
PDS5B_HUMAN

NCBI Description

This gene encodes a protein that interacts with the conserved protein complex termed cohesion. The cohesion complex holds together sister chromatids and facilitates accurate chromosome segregation during mitosis and meiosis. This protein is also a negative regulator of cell proliferation and may be a tumor-suppressor gene. [provided by RefSeq]

Uniprot Description

APRIN: a widely expressed nuclear protein. Is lost in many cancers and may function as a tumor suppressor. Correlates with differentiation in embryonal carcinoma stem cells; its knockdown disrupted Nanog, Oct4, and SOX2 regulation. Plays a role in androgen-induced proliferative arrest in prostate cells. Is upregulated in androgen-sensitive LNCaP prostate cancer cells undergoing androgen-induced proliferative block. Required for maintenance of sister chromatid cohesion during mitosis. May couple sister chromatid cohesion during mitosis to DNA replication. Cohesion ensures that chromosome partitioning is accurate in both meiotic and mitotic cells and plays an important role in DNA repair. Belongs to the PDS5 family. Induced by the synthetic androgen R1881 in prostate carcinoma cells undergoing proliferative arrest. Phosphorylated upon DNA damage. Maximum levels occur 18-20 hours after androgen exposure. Interacts with the cohesin complex. Phosphorylated upon DNA damage, probably by ATM or ATR. Five isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; DNA-binding

Chromosomal Location of Human Ortholog: 13q12.3

Cellular Component: nucleoplasm; chromosome; chromatin; nucleus; cytosol; chromosome, pericentric region

Molecular Function: protein binding; DNA binding; ATP binding

Biological Process: negative regulation of cell proliferation; cell proliferation; cell division; mitotic sister chromatid cohesion; mitotic cell cycle; regulation of cell proliferation

Research Articles on PDS5B

Similar Products

Product Notes

The PDS5B pds5b (Catalog #AAA601694) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PDS5, Regulator of Cohesion Maintenance, Homolog B (PDS5B, APRIN, CG008, FLJ23236, KIAA0979, RP1-267P19.1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDS5, Regulator of Cohesion Maintenance, Homolog B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Gel Shift Assay (GS/EMSA). Suitable for use in Dot Blot and Western Blot. Researchers should empirically determine the suitability of the PDS5B pds5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDS5, Regulator of Cohesion Maintenance, Homolog B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.