Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human DYRK4 Monoclonal Antibody | anti-DYRK4 antibody

DYRK4 (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 4)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DYRK4; Monoclonal Antibody; DYRK4 (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 4); Anti -DYRK4 (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 4); anti-DYRK4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B9
Specificity
Recognizes human DYRK4.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
FFPSETRKDKVQGCHHSSRKADEITKETTEKTKDSPTKHVQHSGDQQDCLQHGADTVQLPQLVDAPKKSEAAVGAEVSMTSPGQSKNFSLKNTNVLPPIV
Applicable Applications for anti-DYRK4 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa421-520 from DYRK4 (AAH31244) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(monoclonal antibody Western Blot analysis of expression in HepG2.)

Western Blot (WB) (monoclonal antibody Western Blot analysis of expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged DYRK4 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DYRK4 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-DYRK4 antibody
Dual-specificity kinases, such as DYRK4, play key roles in cell proliferation, survival, and development (Zhang et al., 2005 [PubMed 15607427]).
Product Categories/Family for anti-DYRK4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,608 Da
NCBI Official Full Name
dual specificity tyrosine-phosphorylation-regulated kinase 4 isoform 3
NCBI Official Synonym Full Names
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
NCBI Official Symbol
DYRK4
NCBI Protein Information
dual specificity tyrosine-phosphorylation-regulated kinase 4
UniProt Protein Name
Dual specificity tyrosine-phosphorylation-regulated kinase 4
UniProt Gene Name
DYRK4
UniProt Entry Name
DYRK4_HUMAN

NCBI Description

This gene encodes an enzyme that belongs to a conserved family of serine/threonine protein kinases. Members of this dual specificity kinase family are thought to function in the regulation of cell differentiation and proliferation, survival, and in development. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Aug 2013]

Uniprot Description

DYRK4: a dual-specificity protein kinase of the DYRK family. Its expression is up-regulated by retinoic-acid-induced differentiation of a human neuronal precursor teratocarcinoma cell line.

Protein type: Protein kinase, dual-specificity (non-receptor); Protein kinase, CMGC; EC 2.7.12.1; Kinase, protein; CMGC group; DYRK family; Dyrk2 subfamily

Chromosomal Location of Human Ortholog: 12p13.32

Cellular Component: intracellular membrane-bound organelle; cytoplasm; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; metal ion binding; protein-tyrosine kinase activity; protein serine/threonine/tyrosine kinase activity; ATP binding

Biological Process: peptidyl-tyrosine phosphorylation

Research Articles on DYRK4

Similar Products

Product Notes

The DYRK4 dyrk4 (Catalog #AAA6013651) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DYRK4 (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 4) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DYRK4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the DYRK4 dyrk4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FFPSETRKDK VQGCHHSSRK ADEITKETTE KTKDSPTKHV QHSGDQQDCL QHGADTVQLP QLVDAPKKSE AAVGAEVSMT SPGQSKNFSL KNTNVLPPIV. It is sometimes possible for the material contained within the vial of "DYRK4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.