Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ZNF79 is ~3ng/ml as a capture antibody.)

Mouse anti-Human ZNF79 Monoclonal Antibody | anti-ZNF79 antibody

ZNF79 (Zinc Finger Protein 79, PT7, ZNFpT7)

Gene Names
ZNF79; pT7
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ZNF79; Monoclonal Antibody; ZNF79 (Zinc Finger Protein 79; PT7; ZNFpT7); Anti -ZNF79 (Zinc Finger Protein 79; anti-ZNF79 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D12
Specificity
Recognizes human ZNF79.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
WRCLVSTPRDRFKEGIPGKSRSLVLLGLPVSQPGMNSQLEQREGAWMLEGEDLRSPSPGWKIISGSPPEQALSEASFQDPCVEMPPGDSDHGTSDLEKSF*
Applicable Applications for anti-ZNF79 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa52-152 from human ZNF79 (NP_009066) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ZNF79 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZNF79 is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-ZNF79 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
55,350 Da
NCBI Official Full Name
Zinc finger protein 79
NCBI Official Synonym Full Names
zinc finger protein 79
NCBI Official Symbol
ZNF79
NCBI Official Synonym Symbols
pT7
NCBI Protein Information
zinc finger protein 79; ZNFpT7
UniProt Protein Name
Zinc finger protein 79
Protein Family
UniProt Gene Name
ZNF79
UniProt Entry Name
ZNF79_HUMAN

Uniprot Description

ZNF79: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 9q34

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent

Research Articles on ZNF79

Similar Products

Product Notes

The ZNF79 znf79 (Catalog #AAA6011748) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF79 (Zinc Finger Protein 79, PT7, ZNFpT7) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF79 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the ZNF79 znf79 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: WRCLVSTPRD RFKEGIPGKS RSLVLLGLPV SQPGMNSQLE QREGAWMLEG EDLRSPSPGW KIISGSPPEQ ALSEASFQDP CVEMPPGDSD HGTSDLEKSF *. It is sometimes possible for the material contained within the vial of "ZNF79, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.