Mouse anti-Human ZNF253 Monoclonal Antibody | anti-ZNF253 antibody
ZNF253 (Zinc Finger Protein 253, Bone Marrow Zinc Finger 1, BMZF1, BMZF-1, Zinc Finger Protein 411, ZNF411)
Gene Names
ZNF253; BMZF1; BMZF-1; ZNF411
Reactivity
Human
Applications
ELISA
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
ZNF253; Monoclonal Antibody; ZNF253 (Zinc Finger Protein 253; Bone Marrow Zinc Finger 1; BMZF1; BMZF-1; Zinc Finger Protein 411; ZNF411); Anti -ZNF253 (Zinc Finger Protein 253; anti-ZNF253 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D7
Specificity
Recognizes human ZNF253.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
QNSFQIGMLRRYEECRHDNLQLKKGCKSVGEHKVHKGGYNGLNQCLTTTQKEIFQCDKYGKVFHKFSNSNTYKTRHTGINLFKCIICGKA
Applicable Applications for anti-ZNF253 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa91-180 from human ZNF253 (NP_066385) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Product Categories/Family for anti-ZNF253 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
57,602 Da
NCBI Official Full Name
zinc finger protein 253
NCBI Official Synonym Full Names
zinc finger protein 253
NCBI Official Symbol
ZNF253
NCBI Official Synonym Symbols
BMZF1; BMZF-1; ZNF411
NCBI Protein Information
zinc finger protein 253; DNA-binding protein; zinc finger protein 411; bone marrow zinc finger 1
UniProt Protein Name
Zinc finger protein 253
Protein Family
UniProt Gene Name
ZNF253
UniProt Synonym Gene Names
BMZF1; ZNF411; BMZF-1
UniProt Entry Name
ZN253_HUMAN
Uniprot Description
ZNF253: May function as a transcription factor. Seem to have a transcriptional repression activity. Belongs to the krueppel C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: C2H2-type zinc finger protein; DNA-binding; Transcription, coactivator/corepressor
Chromosomal Location of Human Ortholog: 19p13.11
Cellular Component: nucleus
Molecular Function: DNA binding; zinc ion binding
Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; negative regulation of transcription, DNA-dependent
Similar Products
Product Notes
The ZNF253 znf253 (Catalog #AAA6010892) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF253 (Zinc Finger Protein 253, Bone Marrow Zinc Finger 1, BMZF1, BMZF-1, Zinc Finger Protein 411, ZNF411) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF253 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the ZNF253 znf253 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QNSFQIGMLR RYEECRHDNL QLKKGCKSVG EHKVHKGGYN GLNQCLTTTQ KEIFQCDKYG KVFHKFSNSN TYKTRHTGIN LFKCIICGKA. It is sometimes possible for the material contained within the vial of "ZNF253, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
