Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of DHDH expression in transfected 293T cell line by DHDH polyclonal antibody. Lane 1: DHDH transfected lysate (36.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human DHDH Polyclonal Antibody | anti-DHDH antibody

DHDH (2DD, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase, D-xylose 1-dehydrogenase, D-xylose-NADP Dehydrogenase, Dimeric Dihydrodiol Dehydrogenase, Hum2DD)

Gene Names
DHDH; CMO2DD
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DHDH; Polyclonal Antibody; DHDH (2DD; Trans-1; 2-dihydrobenzene-1; 2-diol Dehydrogenase; D-xylose 1-dehydrogenase; D-xylose-NADP Dehydrogenase; Dimeric Dihydrodiol Dehydrogenase; Hum2DD); Anti -DHDH (2DD; anti-DHDH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DHDH.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVVGRRHETGVDDTVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR
Applicable Applications for anti-DHDH antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human DHDH, aa1-334 (NP_055290.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DHDH expression in transfected 293T cell line by DHDH polyclonal antibody. Lane 1: DHDH transfected lysate (36.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DHDH expression in transfected 293T cell line by DHDH polyclonal antibody. Lane 1: DHDH transfected lysate (36.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DHDH antibody
DHDH encodes an enzyme that belongs to the family of dihydrodiol dehydrogenases, which exist in multiple forms in mammalian tissues and are involved in the metabolism of xenobiotics and sugars. These enzymes catalyze the NADP1-linked oxidation of transdihydrodiols of aromatic hydrocarbons to corresponding catechols. This enzyme is a dimeric dihydrodiol dehydrogenase, and it differs from monomeric dihydrodiol dehydrogenases in its high substrate specificity for trans-dihydrodiols of aromatic hydrocarbons in the oxidative direction.
Product Categories/Family for anti-DHDH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
dihydrodiol dehydrogenase (dimeric)
NCBI Official Symbol
DHDH
NCBI Official Synonym Symbols
CMO2DD
NCBI Protein Information
dihydrodiol dehydrogenase (dimeric); dihydrodiol dehydrogenase (dimeric); dimeric dihydrodiol dehydrogenase

Similar Products

Product Notes

The DHDH (Catalog #AAA6007254) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DHDH (2DD, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase, D-xylose 1-dehydrogenase, D-xylose-NADP Dehydrogenase, Dimeric Dihydrodiol Dehydrogenase, Hum2DD) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DHDH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the DHDH for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MALRWGIVSV GLISSDFTAV LQTLPRSEHQ VVAVAARDLS RAKEFAQKHD IPKAYGSYEE LAKDPSVEVA YIGTQHPQHK AAVMLCLAAG KAVLCEKPTG VNAAEVREMV AEARSRALFL MEAIWTRFFP ASEALRSVLA QGTLGDLRVA RAEFGKNLIH VPRAVDRAQA GGALLDIGIY CVQFTSMVFG GQKPEKISVV GRRHETGVDD TVTVLLQYPG EVHGSFTCSI TVQLSNTASV SGTKGMVQLL NPCWCPTELV VKGEHKEFPL PPVPKDCNFD NGAGMSYEAK HVWECLRKGM KESPVIPLSE SELLADILEE VRKAIGVTFP QDKR. It is sometimes possible for the material contained within the vial of "DHDH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.