Mouse anti-Human ATP5F1 Polyclonal Antibody | anti-ATP5F1 antibody

ATP5F1 (ATP Synthase Subunit B, Mitochondrial, ATPase Subunit B)

Cat. Num. AAA6007164

• Gene Names: ATP5F1; PIG47
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ATP5F1; Polyclonal Antibody; ATP5F1 (ATP Synthase Subunit B; Mitochondrial; ATPase Subunit B); Anti -ATP5F1 (ATP Synthase Subunit B; anti-ATP5F1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ATP5F1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM

• Applicable Applications for anti-ATP5F1 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human ATP5F1, aa1-256 (NP_001679.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ATP5F1 expression in transfected 293T cell line by ATP5F1 polyclonal antibody. Lane 1: ATP5F1 transfected lysate (28.16kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ATP5F1 antibody

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements.

Product Categories/Family for anti-ATP5F1 antibody

Antibodies; Abs to Enzymes; ATPase

NCBI and Uniprot Product Information

• NCBI GI #: 21361565
• NCBI GeneID: 515
• NCBI Accession #: NP_001679.2
• NCBI GenBank Nucleotide #: NM_001688.4
• UniProt Accession #: P24539; Q9BQ68; Q9BRU8
• Molecular Weight: 28,909 Da
• NCBI Official Full Name: ATP synthase subunit b, mitochondrial
• NCBI Official Synonym Full Names: ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1
• NCBI Official Symbol: ATP5F1
• NCBI Official Synonym Symbols: PIG47
• NCBI Protein Information: ATP synthase subunit b, mitochondrial; ATPase subunit b; H+-ATP synthase subunit b; ATP synthase B chain, mitochondrial; cell proliferation-inducing protein 47; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1
• UniProt Protein Name: ATP synthase F(0) complex subunit B1, mitochondrial
• Protein Family: ATP synthase F(0) complex
• UniProt Gene Name: ATP5F1
• UniProt Synonym Gene Names: ATPase subunit b
• UniProt Entry Name: AT5F1_HUMAN

NCBI Description

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP5F1: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements. Belongs to the eukaryotic ATPase B chain family.

Protein type: EC 3.6.3.14; Mitochondrial; Hydrolase; Energy Metabolism - oxidative phosphorylation

Chromosomal Location of Human Ortholog: 1p13.2

Cellular Component: nucleoplasm; mitochondrion; membrane; mitochondrial matrix; mitochondrial inner membrane; nucleus; mitochondrial proton-transporting ATP synthase complex

Molecular Function: protein binding; ATPase activity; hydrogen ion transporting ATP synthase activity, rotational mechanism; transmembrane transporter activity

Biological Process: cellular metabolic process; ATP synthesis coupled proton transport; substantia nigra development; mitochondrial ATP synthesis coupled proton transport