Mouse anti-Human MPST Monoclonal Antibody | anti-MPST antibody

MPST (3-Mercaptopyruvate Sulfurtransferase, Mercaptopyruvate Sulfurtransferase, MST, MGC24539, TST2)

Cat. Num. AAA6006826

• Gene Names: MPST; MST; TST2
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: MPST; Monoclonal Antibody; MPST (3-Mercaptopyruvate Sulfurtransferase; Mercaptopyruvate Sulfurtransferase; MST; MGC24539; TST2); Anti -MPST (3-Mercaptopyruvate Sulfurtransferase; anti-MPST antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1B5
• Specificity: Recognizes human MPST.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIY

• Applicable Applications for anti-MPST antibody: ELISA (EL/EIA), Immunoprecipitation (IP)
• Application Notes: Suitable for use in ELISA and Immunoprecipitation.
• Immunogen: Partial recombinant corresponding to aa1-100 from human MPST (NP_001013454.1) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of MPST transfected lysate using anti-MPST monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MPST rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged MPST is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-MPST antibody

MPST catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this protein (mercaptopyruvate sulfurtransferase, MPST), which appears to be cytoplasmic, and thiosulfate sulfurtransferase (rhodanese, TST), which is a mitochondrial protein. Deficiency in MPST activity has been implicated in a rare inheritable disorder known as mercaptolactate-cysteine disulfiduria (MCDU).

Product Categories/Family for anti-MPST antibody

Antibodies; Abs to Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 47678577
• NCBI GeneID: 4357
• UniProt Accession #: P25325; O75750
• Molecular Weight: 33,178 Da
• NCBI Official Full Name: MPST
• NCBI Official Synonym Full Names: mercaptopyruvate sulfurtransferase
• NCBI Official Symbol: MPST
• NCBI Official Synonym Symbols: MST; TST2
• NCBI Protein Information: 3-mercaptopyruvate sulfurtransferase; human liver rhodanese
• UniProt Protein Name: 3-mercaptopyruvate sulfurtransferase
• Protein Family: 3-mercaptopyruvate sulfurtransferase
• UniProt Gene Name: MPST
• UniProt Synonym Gene Names: TST2; MST
• UniProt Entry Name: THTM_HUMAN

NCBI Description

This protein encoded by this gene catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this protein (mercaptopyruvate sulfurtransferase, MPST), which appears to be cytoplasmic, and thiosulfate sulfurtransferase (rhodanese, TST, GeneID:7263), which is a mitochondrial protein. Deficiency in MPST activity has been implicated in a rare inheritable disorder known as mercaptolactate-cysteine disulfiduria (MCDU). Alternatively spliced transcript variants encoding same or different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

MPST: Transfer of a sulfur ion to cyanide or to other thiol compounds. Also has weak rhodanese activity. May have a role in cyanide degradation or in thiosulfate biosynthesis.

Protein type: EC 2.8.1.2; Transferase; Mitochondrial; Amino Acid Metabolism - cysteine and methionine

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: neuron projection; mitochondrial inner membrane; synapse; cell junction

Molecular Function: 3-mercaptopyruvate sulfurtransferase activity; thiosulfate sulfurtransferase activity

Biological Process: cyanate catabolic process; response to toxin