Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human, Mouse NDOR1 Monoclonal Antibody | anti-NDOR1 antibody

NDOR1 (NR1, NADPH-dependent Diflavin Oxidoreductase 1, NADPH-dependent FMN and FAD-containing Oxidoreductase, Novel Reductase 1)

Gene Names
NDOR1; NR1; bA350O14.9
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NDOR1; Monoclonal Antibody; NDOR1 (NR1; NADPH-dependent Diflavin Oxidoreductase 1; NADPH-dependent FMN and FAD-containing Oxidoreductase; Novel Reductase 1); Anti -NDOR1 (NR1; anti-NDOR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A11
Specificity
Recognizes human NDOR1. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
EWQELEKRDCLTLIPAFSREQEQKVYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTET*
Applicable Applications for anti-NDOR1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa498-596 from human NDOR1 (NP_055249) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(NDOR1 monoclonal antibody Western Blot analysis of NDOR1 expression in HeLa.)

Western Blot (WB) (NDOR1 monoclonal antibody Western Blot analysis of NDOR1 expression in HeLa.)

Western Blot (WB)

(NDOR1 monoclonal antibody Western Blot analysis of NDOR1 expression in NIH/3T3.)

Western Blot (WB) (NDOR1 monoclonal antibody Western Blot analysis of NDOR1 expression in NIH/3T3.)

Western Blot (WB)

(Western Blot analysis of NDOR1 expression in transfected 293T cell line by NDOR1 monoclonal antibody.|Lane 1: NDOR1 transfected lysate (66.8kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NDOR1 expression in transfected 293T cell line by NDOR1 monoclonal antibody.|Lane 1: NDOR1 transfected lysate (66.8kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged NDOR1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NDOR1 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-NDOR1 antibody
This gene encodes an NADPH-dependent diflavin reductase that contains both flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) binding domains. The encoded protein is an enzyme that catalyzes the transfers electrons from NADPH through FAD and FMN cofactors to potential redox partners. Alternative splicing results in multiple transcript variants. [provided by RefSeq].
Product Categories/Family for anti-NDOR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66,763 Da
NCBI Official Full Name
NADPH-dependent diflavin oxidoreductase 1 isoform c
NCBI Official Synonym Full Names
NADPH dependent diflavin oxidoreductase 1
NCBI Official Symbol
NDOR1
NCBI Official Synonym Symbols
NR1; bA350O14.9
NCBI Protein Information
NADPH-dependent diflavin oxidoreductase 1; NADPH-dependent FMN and FAD-containing oxidoreductase
UniProt Protein Name
NADPH-dependent diflavin oxidoreductase 1
UniProt Gene Name
NDOR1
UniProt Synonym Gene Names
NR1
UniProt Entry Name
NDOR1_HUMAN

NCBI Description

This gene encodes an NADPH-dependent diflavin reductase that contains both flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) binding domains. The encoded protein catalyzes the transfer of electrons from NADPH through FAD and FMN cofactors to potential redox partners. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2012]

Uniprot Description

NDOR1: Oxidoreductase that catalyzes the NADP-dependent reduction of cytochrome c and one-electron acceptors, such as doxorubicin, potassium ferricyanide and menadione (in vitro). 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Oxidoreductase; EC 1.6.-.-

Chromosomal Location of Human Ortholog: 9q34.3

Cellular Component: intermediate filament cytoskeleton; perinuclear region of cytoplasm; cytoplasm; cytosol; nucleus

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NADH or NADPH as one donor, and incorporation of one atom of oxygen; protein binding; FAD binding; NADPH-hemoprotein reductase activity; FMN binding; iron ion binding; oxidoreductase activity; NADP binding

Biological Process: cell death; iron-sulfur cluster assembly

Research Articles on NDOR1

Similar Products

Product Notes

The NDOR1 ndor1 (Catalog #AAA6006755) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NDOR1 (NR1, NADPH-dependent Diflavin Oxidoreductase 1, NADPH-dependent FMN and FAD-containing Oxidoreductase, Novel Reductase 1) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NDOR1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the NDOR1 ndor1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EWQELEKRDC LTLIPAFSRE QEQKVYVQHR LRELGSLVWE LLDRQGAYFY LAGNAKSMPA DVSEALMSIF QEEGGLCSPD AAAYLARLQQ TRRFQTET*. It is sometimes possible for the material contained within the vial of "NDOR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.