Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of KPTN expression in transfected 293T cell line by KPTN polyclonal antibody. Lane 1: KPTN transfected lysate (48.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human KPTN Polyclonal Antibody | anti-KPTN antibody

KPTN (Kaptin, 2E4, Actin-associated Protein 2E4)

Gene Names
KPTN; 2E4
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
KPTN; Polyclonal Antibody; KPTN (Kaptin; 2E4; Actin-associated Protein 2E4); Anti -KPTN (Kaptin; anti-KPTN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human KPTN.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MMGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVLGFRYQDLRQKIRPVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYEPGSEYNLDSIAQSCLNLELQFTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPISRVIVFSLSAAKETKDRPLQDEYSVLVASMLEPAVVYRDLLNRGLEDQLLLPGSDQFDSVLCSLVTDVDLDGRPEVLVATYGQELLCYKYRGPESGLPEAQHGFHLLWQRSFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQASELVLTRLRHQVEQRRRRLQGLEDGAGAGPAENAAS
Applicable Applications for anti-KPTN antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human KPTN, aa1-436 (NP_008990.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of KPTN expression in transfected 293T cell line by KPTN polyclonal antibody. Lane 1: KPTN transfected lysate (48.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KPTN expression in transfected 293T cell line by KPTN polyclonal antibody. Lane 1: KPTN transfected lysate (48.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-KPTN antibody
KPTN may be involved in actin dynamics. May play a role in producing the sensory apparatus in hair cells. May play a role in actin rearrangements that accompany platelet activation and stereocilia formation.
Product Categories/Family for anti-KPTN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,080 Da
NCBI Official Full Name
kaptin
NCBI Official Synonym Full Names
kaptin (actin binding protein)
NCBI Official Symbol
KPTN
NCBI Official Synonym Symbols
2E4
NCBI Protein Information
kaptin; actin-associated protein 2E4; kaptin (actin-binding protein)
UniProt Protein Name
Kaptin
Protein Family
UniProt Gene Name
KPTN
UniProt Entry Name
KPTN_HUMAN

NCBI Description

This gene encodes a filamentous-actin-associated protein, which is involved in actin dynamics and plays an important role in neuromorphogenesis. Mutations in this gene result in recessive mental retardation-41. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Apr 2014]

Uniprot Description

KPTN: May be involved in actin dynamics. May play a role in producing the sensory apparatus in hair cells. May play a role in actin rearrangements that accompany platelet activation and stereocilia formation.

Protein type: Motility/polarity/chemotaxis; Actin-binding; Cytoskeletal

Chromosomal Location of Human Ortholog: 19q13.32

Cellular Component: stereocilium; growth cone; perinuclear region of cytoplasm; microtubule organizing center; nucleus; actin cytoskeleton

Molecular Function: actin binding

Biological Process: sensory perception of sound; actin filament organization; cell motility

Disease: Mental Retardation, Autosomal Recessive 41

Similar Products

Product Notes

The KPTN kptn (Catalog #AAA6006529) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KPTN (Kaptin, 2E4, Actin-associated Protein 2E4) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KPTN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the KPTN kptn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MMGEAAVAAG PCPLREDSFT RFSSQSNVYG LAGGAGGRGE LLAATLKGKV LGFRYQDLRQ KIRPVAKELQ FNYIPVDAEI VSIDTFNKSP PKRGLVVGIT FIKDSGDKGS PFLNIYCDYE PGSEYNLDSI AQSCLNLELQ FTPFQLCHAE VQVGDQLETV FLLSGNDPAI HLYKENEGLH QFEEQPVENL FPELTNLTSS VLWLDVHNFP GTSRRLSALG CQSGYVRVAH VDQRSREVLQ MWSVLQDGPI SRVIVFSLSA AKETKDRPLQ DEYSVLVASM LEPAVVYRDL LNRGLEDQLL LPGSDQFDSV LCSLVTDVDL DGRPEVLVAT YGQELLCYKY RGPESGLPEA QHGFHLLWQR SFSSPLLAMA HVDLTGDGLQ ELAVVSLKGV HILQHSLIQA SELVLTRLRH QVEQRRRRLQ GLEDGAGAGP AENAAS. It is sometimes possible for the material contained within the vial of "KPTN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.