Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of YBX2 expression in transfected 293T cell line by YBX2 polyclonal antibody. Lane 1: YBX2 transfected lysate (38.6kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human YBX2 Polyclonal Antibody | anti-YBX2 antibody

YBX2 (Y-box-binding Protein 2, Contrin, CSDA3, DNA-binding Protein C, Dbpc, Germ Cell-specific Y-box-binding Protein, MSY2, MSY2 Homolog)

Gene Names
YBX2; DBPC; MSY2; CSDA3; CONTRIN
Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Purity
Serum
Serum
Synonyms
YBX2; Polyclonal Antibody; YBX2 (Y-box-binding Protein 2; Contrin; CSDA3; DNA-binding Protein C; Dbpc; Germ Cell-specific Y-box-binding Protein; MSY2; MSY2 Homolog); Anti -YBX2 (Y-box-binding Protein 2; anti-YBX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human YBX2.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MSEVEAAAVATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRRKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPPFFYRRRFVRGPRPPNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPRYRRPFRPRPRQQPTTEGGDGETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETSAPVNSGDPTTTILE
Applicable Applications for anti-YBX2 antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in Western Blot and Immunoprecipitation.
Immunogen
Full length human YBX2, aa1-364 (NP_057066.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of YBX2 expression in transfected 293T cell line by YBX2 polyclonal antibody. Lane 1: YBX2 transfected lysate (38.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of YBX2 expression in transfected 293T cell line by YBX2 polyclonal antibody. Lane 1: YBX2 transfected lysate (38.6kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of YBX2 transfected lysate using YBX2 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with YBX2 mouse polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of YBX2 transfected lysate using YBX2 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with YBX2 mouse polyclonal antibody.)
Product Categories/Family for anti-YBX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,518 Da
NCBI Official Full Name
Y-box-binding protein 2
NCBI Official Synonym Full Names
Y box binding protein 2
NCBI Official Symbol
YBX2
NCBI Official Synonym Symbols
DBPC; MSY2; CSDA3; CONTRIN
NCBI Protein Information
Y-box-binding protein 2; MSY2 homolog; DNA-binding protein C; germ cell specific Y-box binding protein; germ cell-specific Y-box-binding protein
UniProt Protein Name
Y-box-binding protein 2
Protein Family
UniProt Gene Name
YBX2
UniProt Synonym Gene Names
CSDA3; MSY2; Dbpc
UniProt Entry Name
YBOX2_HUMAN

NCBI Description

This gene encodes a nucleic acid binding protein which is highly expressed in germ cells. The encoded protein binds to a Y-box element in the promoters of certain genes but also binds to mRNA transcribed from these genes. Pseudogenes for this gene are located on chromosome 10 and 15. [provided by RefSeq, Feb 2012]

Uniprot Description

YBX2: Major constituent of messenger ribonucleoprotein particles (mRNPs). Involved in the regulation of the stability and/or translation of germ cell mRNAs. Binds to Y-box consensus promoter element. Binds to full length mRNA with high affinity in a sequence-independent manner. Binds to short RNA sequences containing the consensus site 5'-UCCAUCA-3' with low affinity and limited sequence specificity. Its binding with maternal mRNAs is necessary for its cytoplasmic retention. May mark specific mRNAs (those transcribed from Y-box promoters) in the nucleus for cytoplasmic storage, thereby linking transcription and mRNA storage/translational delay.

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: polysome; cytoplasm; nucleolus; nucleus

Molecular Function: ribonucleoprotein binding; mRNA 3'-UTR binding; DNA binding; translation regulator activity; chromatin binding; lipid binding

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; translational attenuation; negative regulation of translation; mRNA stabilization; spermatogenesis; negative regulation of binding; spermatid development; oocyte development

Research Articles on YBX2

Similar Products

Product Notes

The YBX2 ybx2 (Catalog #AAA6004805) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The YBX2 (Y-box-binding Protein 2, Contrin, CSDA3, DNA-binding Protein C, Dbpc, Germ Cell-specific Y-box-binding Protein, MSY2, MSY2 Homolog) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's YBX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). Suitable for use in Western Blot and Immunoprecipitation. Researchers should empirically determine the suitability of the YBX2 ybx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSEVEAAAVA TAVPAATVPA TAAGVVAVVV PVPAGEPQKG GGAGGGGGAA SGPAAGTPSA PGSRTPGNPA TAVSGTPAPP ARSQADKPVL AIQVLGTVKW FNVRNGYGFI NRNDTKEDVF VHQTAIKRNN PRKFLRSVGD GETVEFDVVE GEKGAEATNV TGPGGVPVKG SRYAPNRRKS RRFIPRPPSV APPPMVAEIP SAGTGPGSKG ERAEDSGQRP RRWCPPPFFY RRRFVRGPRP PNQQQPIEGT DRVEPKETAP LEGHQQQGDE RVPPPRFRPR YRRPFRPRPR QQPTTEGGDG ETKPSQGPAD GSRPEPQRPR NRPYFQRRRQ QAPGPQQAPG PRQPAAPETS APVNSGDPTT TILE. It is sometimes possible for the material contained within the vial of "YBX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.