Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human RSAD2 Monoclonal Antibody | anti-RSAD2 antibody

RSAD2 (Radical S-adenosyl Methionine Domain-containing Protein 2, Cytomegalovirus-induced Gene 5 Protein, CIG5, Viperin, Virus Inhibitory Protein, Endoplasmic Reticulum-associated, Interferon-inducible)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RSAD2; Monoclonal Antibody; RSAD2 (Radical S-adenosyl Methionine Domain-containing Protein 2; Cytomegalovirus-induced Gene 5 Protein; CIG5; Viperin; Virus Inhibitory Protein; Endoplasmic Reticulum-associated; Interferon-inducible); Anti -RSAD2 (Radical S-adenosyl Methionine Domain-containing Protein 2; anti-RSAD2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D10
Specificity
Recognizes human RSAD2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
ALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW
Applicable Applications for anti-RSAD2 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa262-362 from human RSAD2 (NP_542388) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of RSAD2 expression in transfected 293T cell line by RSAD2 monoclonal antibody.|Lane 1: RSAD2 transfected lysate (Predicted MW: 42.2kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RSAD2 expression in transfected 293T cell line by RSAD2 monoclonal antibody.|Lane 1: RSAD2 transfected lysate (Predicted MW: 42.2kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged RSAD2 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RSAD2 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-RSAD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,672 Da
NCBI Official Full Name
radical S-adenosyl methionine domain-containing protein 2
NCBI Official Synonym Full Names
radical S-adenosyl methionine domain containing 2<
NCBI Official Symbol
RSAD2
NCBI Protein Information
radical S-adenosyl methionine domain-containing protein 2; viperin; virus inhibitory protein, endoplasmic reticulum-associated, interferon-inducible
UniProt Protein Name
Radical S-adenosyl methionine domain-containing protein 2
UniProt Gene Name
RSAD2
UniProt Entry Name
RSAD2_BOVIN

Uniprot Description

Function: Interferon-inducible iron-sulfur (4FE-4S) cluster-binding antiviral protein which plays a major role in the cell antiviral state induced by type I and type II interferon. Can inhibit a wide range of viruses, including west Nile virus (WNV), dengue virus, sindbis virus, influenza A virus, sendai virus and vesicular stomatitis virus (VSV). Displays antiviral activity against influenza A virus by inhibiting the budding of the virus from the plasma membrane by disturbing the lipid rafts. This is accomplished, at least in part, through binding and inhibition of the enzyme farnesyl diphospate synthase (FPPS), which is essential for the biosynthesis of isoprenoid-derived lipids. Promotes TLR7 and TLR9-dependent production of IFN-beta production in plasmacytoid dendritic cells (pDCs) by facilitating Lys-63'-linked ubiquitination of IRAK1. Plays a role in CD4+ T-cells activation and differentiation. Facilitates T-cell receptor (TCR)-mediated GATA3 activation and optimal T helper 2 (Th2) cytokine production by modulating NFKB1 and JUNB activities. Can inhibit secretion of soluble proteins

By similarity.

Cofactor: Binds 1 4Fe-4S cluster. The cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L-methionine

By similarity.

Subunit structure: Homodimer. Interacts (via C-terminus) with VAPA/VAP33 (via C-terminus) and inhibits its interaction with hepatitis virus C (HCV) protein NS5A. Interacts with HADHB, IRAK1 and TRAF6

By similarity.

Subcellular location: Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side

By similarity. Lipid droplet

By similarity.

Induction: By interferon type I, type II and LPS.

Domain: The N-terminal region (1-42) is necessary for its localization to the endoplasmic reticulum membrane and lipid droplet

By similarity.

Sequence similarities: Belongs to the radical SAM superfamily. RSAD2 family.

Similar Products

Product Notes

The RSAD2 rsad2 (Catalog #AAA6004725) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RSAD2 (Radical S-adenosyl Methionine Domain-containing Protein 2, Cytomegalovirus-induced Gene 5 Protein, CIG5, Viperin, Virus Inhibitory Protein, Endoplasmic Reticulum-associated, Interferon-inducible) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RSAD2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the RSAD2 rsad2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ALREAERFVI GDEEFERFLE RHKEVSCLVP ESNQKMKDSY LILDEYMRFL NCRKGRKDPS KSILDVGVEE AIKFSGFDEK MFLKRGGKYI WSKADLKLDW. It is sometimes possible for the material contained within the vial of "RSAD2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.