Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DHRS9 polyclonal antibody. Western Blot analysis of DHRS9 expression in A-431.)

Mouse anti-Human DHRS9 Polyclonal Antibody | anti-DHRS9 antibody

DHRS9 (Dehydrogenase/Reductase SDR Family Member 9, 3-alpha Hydroxysteroid Dehydrogenase, NADP-dependent Retinol Dehydrogenase/Reductase, RDH-E2, RDHL, Short-chain Dehydrogenase/Reductase retSDR8, UNQ835/PRO1773)

Gene Names
DHRS9; RDHL; RDH15; RDHTBE; SDR9C4; RDH-TBE; RETSDR8; 3ALPHA-HSD
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DHRS9; Polyclonal Antibody; DHRS9 (Dehydrogenase/Reductase SDR Family Member 9; 3-alpha Hydroxysteroid Dehydrogenase; NADP-dependent Retinol Dehydrogenase/Reductase; RDH-E2; RDHL; Short-chain Dehydrogenase/Reductase retSDR8; UNQ835/PRO1773); Anti -DHRS9 (Dehydrogenase/Reductase SDR Family Member 9; anti-DHRS9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DHRS9.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV
Applicable Applications for anti-DHRS9 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full-length human DHRS9, aa1-319 (NP_005762.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(DHRS9 polyclonal antibody. Western Blot analysis of DHRS9 expression in A-431.)

Western Blot (WB) (DHRS9 polyclonal antibody. Western Blot analysis of DHRS9 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of DHRS9 expression in transfected 293T cell line by DHRS9 polyclonal antibody. Lane 1: DHRS9 transfected lysate (35.09kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DHRS9 expression in transfected 293T cell line by DHRS9 polyclonal antibody. Lane 1: DHRS9 transfected lysate (35.09kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DHRS9 antibody
3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. May play a role in the biosynthesis of retinoic acid from retinaldehyde, but seems to have low activity with retinoids. Can utilize both NADH and NADPH.
Product Categories/Family for anti-DHRS9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,227 Da
NCBI Official Full Name
dehydrogenase/reductase SDR family member 9
NCBI Official Synonym Full Names
dehydrogenase/reductase (SDR family) member 9
NCBI Official Symbol
DHRS9
NCBI Official Synonym Symbols
RDHL; RDH15; RDHTBE; SDR9C4; RDH-TBE; RETSDR8; 3ALPHA-HSD
NCBI Protein Information
dehydrogenase/reductase SDR family member 9; RDH-E2; 3-alpha-HSD; retinol dehydrogenase homolog; 3-alpha hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase retSDR8; NADP-dependent retinol dehydrogenase/reductase; short chain dehydrogenase/reductase family 9C, member 4; tracheobronchial epithelial cell-specific retinol dehydrogenase
UniProt Protein Name
Dehydrogenase/reductase SDR family member 9
UniProt Gene Name
DHRS9
UniProt Synonym Gene Names
3-alpha-HSD; RDH-TBE
UniProt Entry Name
DHRS9_HUMAN

NCBI Description

This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoreductase activity toward hydroxysteroids and is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]

Uniprot Description

DHRS9: 3-alpha-hydroxysteroid dehydrogenase that converts 3- alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. May play a role in the biosynthesis of retinoic acid from retinaldehyde, but seems to have low activity with retinoids. Can utilize both NADH and NADPH. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Oxidoreductase; Cofactor and Vitamin Metabolism - retinol; EC 1.1.-.-; Secreted; Endoplasmic reticulum; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 2q31.1

Cellular Component: endoplasmic reticulum membrane; integral to endoplasmic reticulum membrane

Molecular Function: alcohol dehydrogenase activity; racemase and epimerase activity; 3-alpha(17-beta)-hydroxysteroid dehydrogenase (NAD+) activity; retinol dehydrogenase activity

Biological Process: epithelial cell differentiation; retinol metabolic process; androgen metabolic process; 9-cis-retinoic acid biosynthetic process; progesterone metabolic process

Research Articles on DHRS9

Similar Products

Product Notes

The DHRS9 dhrs9 (Catalog #AAA6003235) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DHRS9 (Dehydrogenase/Reductase SDR Family Member 9, 3-alpha Hydroxysteroid Dehydrogenase, NADP-dependent Retinol Dehydrogenase/Reductase, RDH-E2, RDHL, Short-chain Dehydrogenase/Reductase retSDR8, UNQ835/PRO1773) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DHRS9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the DHRS9 dhrs9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLFWVLGLLI LCGFLWTRKG KLKIEDITDK YIFITGCDSG FGNLAARTFD KKGFHVIAAC LTESGSTALK AETSERLRTV LLDVTDPENV KRTAQWVKNQ VGEKGLWGLI NNAGVPGVLA PTDWLTLEDY REPIEVNLFG LISVTLNMLP LVKKAQGRVI NVSSVGGRLA IVGGGYTPSK YAVEGFNDSL RRDMKAFGVH VSCIEPGLFK TNLADPVKVI EKKLAIWEQL SPDIKQQYGE GYIEKSLDKL KGNKSYVNMD LSPVVECMDH ALTSLFPKTH YAAGKDAKIF WIPLSHMPAA LQDFLLLKQK AELANPKAV. It is sometimes possible for the material contained within the vial of "DHRS9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.