Western Blot (WB)
(Western Blot analysis of ELL3 expression in transfected 293T cell line by ELL3 polyclonal antibody. Lane 1: ELL3 transfected lysate (43.78kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human ELL3 Polyclonal Antibody | anti-ELL3 antibody
ELL3 (RNA Polymerase II Elongation Factor ELL3, FLJ22637)
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
ELL3; Polyclonal Antibody; ELL3 (RNA Polymerase II Elongation Factor ELL3; FLJ22637); Anti -ELL3 (RNA Polymerase II Elongation Factor ELL3; anti-ELL3 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ELL3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIAFQGHRGYLRLPGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSSREHMAQWEVRSQTHVPNREPVQALPSSASRKRLDKKRSVPVATVELEEKRFRTLPLVPSPLQGLTNQDLQEGEDWEQEDEDMGPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQHAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLEDKIIQEYKKFRKQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS
Applicable Applications for anti-ELL3 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human ELL3, aa1-398 (AAH19293).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of ELL3 expression in transfected 293T cell line by ELL3 polyclonal antibody. Lane 1: ELL3 transfected lysate (43.78kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of ELL3 expression in transfected 293T cell line by ELL3 polyclonal antibody. Lane 1: ELL3 transfected lysate (43.78kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ELL3 antibody
Enhancer-binding elongation factor that specifically binds enhancers in embryonic stem cells (ES cells), marks them, and is required for their future activation during stem cell specification. Does not only bind to enhancer regions of active genes, but also marks the enhancers that are in a poised or inactive state in ES cells and is required for establishing proper RNA polymerase II occupancy at developmentally regulated genes in a cohesin-dependent manner. Probably required for priming developmentally regulated genes for later recruitment of the super elongation complex (SEC), for transcriptional activation during differentiation. Required for recruitment of P-TEFb within SEC during differentiation. Probably preloaded on germ cell chromatin, suggesting that it may prime gene activation by marking enhancers as early as in the germ cells. Promoting epithelial-mesenchymal transition (EMT) By similarity. Elongation factors can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA.
Product Categories/Family for anti-ELL3 antibody
NCBI and Uniprot Product Information
Uniprot Description
ELL3: Elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA. Belongs to the ELL/occludin family.
Chromosomal Location of Human Ortholog: 15q15.3
Cellular Component: nucleoplasm; transcription elongation factor complex; nucleolus; nucleus
Biological Process: transcription from RNA polymerase II promoter; positive regulation of neurogenesis; RNA elongation; positive regulation of RNA elongation; RNA elongation from RNA polymerase II promoter; snRNA transcription from RNA polymerase II promoter; spermatogenesis; positive regulation of transcription from RNA polymerase II promoter; stem cell differentiation
Similar Products
Product Notes
The ELL3 ell3 (Catalog #AAA6002214) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ELL3 (RNA Polymerase II Elongation Factor ELL3, FLJ22637) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ELL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the ELL3 ell3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEELQEPLRG QLRLCFTQAA RTSLLLLRLN DAALRALQEC QRQQVRPVIA FQGHRGYLRL PGPGWSCLFS FIVSQCCQEG AGGSLDLVCQ RFLRSGPNSL HCLGSLRERL IIWAAMDSIP APSSVQGHNL TEDARHPESW QNTGGYSEGD AVSQPQMALE EVSVSDPLAS NQGQSLPGSS REHMAQWEVR SQTHVPNREP VQALPSSASR KRLDKKRSVP VATVELEEKR FRTLPLVPSP LQGLTNQDLQ EGEDWEQEDE DMGPRLEHSS SVQEDSESPS PEDIPDYLLQ YRAIHSAEQQ HAYEQDFETD YAEYRILHAR VGTASQRFIE LGAEIKRVRR GTPEYKVLED KIIQEYKKFR KQYPSYREEK RRCEYLHQKL SHIKGLILEF EEKNRGS. It is sometimes possible for the material contained within the vial of "ELL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
