Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ZNF471 polyclonal antibody. Western Blot analysis of ZNF471 expression in RIN-m5F.)

Mouse anti-Human, Rat ZNF471 Polyclonal Antibody | anti-ZNF471 antibody

ZNF471 (Zinc Finger Protein 471, EZFIT-related Protein 1, ERP1, KIAA1396, Z1971)

Gene Names
ZNF471; ERP1; Z1971
Reactivity
Human, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ZNF471; Polyclonal Antibody; ZNF471 (Zinc Finger Protein 471; EZFIT-related Protein 1; ERP1; KIAA1396; Z1971); Anti -ZNF471 (Zinc Finger Protein 471; anti-ZNF471 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ZNF471. Species Crossreactivity: rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MNVEVVKVMPQDLVTFKDVAIDFSQEEWQWMNPAQKRLYRSMMLENYQSLVSLGLCISKPYVISLLEQGREPWEMTSEMTRSPFSDWESIYVTQELPLKQFMYDDACMEGITSYGLECSTFEENWKWEDLFEKQMGSHEMFSKKEIITHKETITKETEFKYTKFGKCIHLENIEESIYNHTSDKKSFSKNSMVIKHKKVYVGKKLFKCNECDKTFTHSSSLTVHFRIHTGEKPYACEECGKAFKQRQHLAQHHRTHTGEKLFECKECRKAFKQSEHLIQHQRIHTGEKPYKCKECRKAFRQPAHLAQHQRIHTGEKPYECKECGKAFSDGSSFARHQRCHTGKRPYECIECGKAFRYNTSFIRHWRSYHTGEKPFNCIDCGKAFSVHIGLILHRRIHTGEKPYKCGVCGKTFSSGSSRTVHQRIHTGEKPYECDICGKDFSHHASLTQHQRVHSGEKPYECKECGKAFRQNVHLVSHLRIHTGEKPYECKECGKAFRISSQLATHQRIHTGEKPYECIECGNAFKQRSHLAQHQKTHTGEKPYECNECGKAFSQTSNLTQHQRIHTGEKPYKCTECGKAFSDSSSCAQHQRLHTGQRPYQCFECGKAFRRKLSLICHQRSHTGEEP
Applicable Applications for anti-ZNF471 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human ZNF471, aa1-626 (NP_065864.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ZNF471 polyclonal antibody. Western Blot analysis of ZNF471 expression in RIN-m5F.)

Western Blot (WB) (ZNF471 polyclonal antibody. Western Blot analysis of ZNF471 expression in RIN-m5F.)

Western Blot (WB)

(Western Blot analysis of ZNF471 expression in transfected 293T cell line by ZNF471 polyclonal antibody. Lane 1: ZNF471 transfected lysate (68.86kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ZNF471 expression in transfected 293T cell line by ZNF471 polyclonal antibody. Lane 1: ZNF471 transfected lysate (68.86kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to ZNF471 on Daoy cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to ZNF471 on Daoy cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-ZNF471 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
73,009 Da
NCBI Official Full Name
Zinc finger protein 471
NCBI Official Synonym Full Names
zinc finger protein 471
NCBI Official Symbol
ZNF471
NCBI Official Synonym Symbols
ERP1; Z1971
NCBI Protein Information
zinc finger protein 471; EZFIT-related protein 1
UniProt Protein Name
Zinc finger protein 471
Protein Family
UniProt Gene Name
ZNF471
UniProt Synonym Gene Names
ERP1; KIAA1396
UniProt Entry Name
ZN471_HUMAN

Uniprot Description

ZNF471: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 19q13.43

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent

Similar Products

Product Notes

The ZNF471 znf471 (Catalog #AAA6001235) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF471 (Zinc Finger Protein 471, EZFIT-related Protein 1, ERP1, KIAA1396, Z1971) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF471 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the ZNF471 znf471 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNVEVVKVMP QDLVTFKDVA IDFSQEEWQW MNPAQKRLYR SMMLENYQSL VSLGLCISKP YVISLLEQGR EPWEMTSEMT RSPFSDWESI YVTQELPLKQ FMYDDACMEG ITSYGLECST FEENWKWEDL FEKQMGSHEM FSKKEIITHK ETITKETEFK YTKFGKCIHL ENIEESIYNH TSDKKSFSKN SMVIKHKKVY VGKKLFKCNE CDKTFTHSSS LTVHFRIHTG EKPYACEECG KAFKQRQHLA QHHRTHTGEK LFECKECRKA FKQSEHLIQH QRIHTGEKPY KCKECRKAFR QPAHLAQHQR IHTGEKPYEC KECGKAFSDG SSFARHQRCH TGKRPYECIE CGKAFRYNTS FIRHWRSYHT GEKPFNCIDC GKAFSVHIGL ILHRRIHTGE KPYKCGVCGK TFSSGSSRTV HQRIHTGEKP YECDICGKDF SHHASLTQHQ RVHSGEKPYE CKECGKAFRQ NVHLVSHLRI HTGEKPYECK ECGKAFRISS QLATHQRIHT GEKPYECIEC GNAFKQRSHL AQHQKTHTGE KPYECNECGK AFSQTSNLTQ HQRIHTGEKP YKCTECGKAF SDSSSCAQHQ RLHTGQRPYQ CFECGKAFRR KLSLICHQRS HTGEEP. It is sometimes possible for the material contained within the vial of "ZNF471, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.