Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (84.59kD).)

Mouse anti-Human SOCS6 Monoclonal Antibody | anti-SOCS6 antibody

SOCS6 (Suppressor of Cytokine Signaling 6, SOCS-6, Cytokine-inducible SH2 Protein 4, CIS4, CIS-4, Suppressor of Cytokine Signaling 4, SOCS4, SOCS-4)

Gene Names
SOCS6; CIS4; SSI4; CIS-4; SOCS4; STAI4; SOCS-4; SOCS-6; STATI4; HSPC060
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SOCS6; Monoclonal Antibody; SOCS6 (Suppressor of Cytokine Signaling 6; SOCS-6; Cytokine-inducible SH2 Protein 4; CIS4; CIS-4; Suppressor of Cytokine Signaling 4; SOCS4; SOCS-4); Anti -SOCS6 (Suppressor of Cytokine Signaling 6; anti-SOCS6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
M2-F12
Specificity
Recognizes human SOCS6.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGEDEKGGKNRSKSESLMGTLKRRLSAKQKSKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQRPIRSTSLRSHHYSPAPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSYCLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSPRAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
Applicable Applications for anti-SOCS6 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant corresponding to aa1-535 from SOCS6 (AAH20082) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (84.59kD).)

Western Blot (WB) (Western Blot detection against Immunogen (84.59kD).)

Testing Data

(Detection limit for recombinant GST tagged SOCS6 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SOCS6 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-SOCS6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,528 Da
NCBI Official Full Name
suppressor of cytokine signaling 6
NCBI Official Synonym Full Names
suppressor of cytokine signaling 6
NCBI Official Symbol
SOCS6
NCBI Official Synonym Symbols
CIS4; SSI4; CIS-4; SOCS4; STAI4; SOCS-4; SOCS-6; STATI4; HSPC060
NCBI Protein Information
suppressor of cytokine signaling 6; STAT induced STAT inhibitor-4; cytokine-inducible SH2 protein 4; suppressor of cytokine signaling 4
UniProt Protein Name
Suppressor of cytokine signaling 6
UniProt Gene Name
SOCS6
UniProt Synonym Gene Names
CIS4; SOCS4; SOCS-6; CIS-4; SOCS-4
UniProt Entry Name
SOCS6_HUMAN

NCBI Description

The protein encoded by this gene contains a SH2 domain and a CIS homolog domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein family. CIS family members are known to be cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by GM-CSF and EPO in hematopoietic cells. A high expression level of this gene was found in factor-independent chronic myelogenous leukemia (CML) and erythroleukemia (HEL) cell lines. [provided by RefSeq, Jul 2008]

Uniprot Description

SOCS6: SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. May be a substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Regulates KIT degradation by ubiquitination of the tyrosine-phosphorylated receptor.

Protein type: Inhibitor

Chromosomal Location of Human Ortholog: 18q22.2

Cellular Component: cytoplasm; immunological synapse

Molecular Function: protein binding; protein kinase inhibitor activity

Biological Process: proteasomal protein catabolic process; regulation of growth; cytokine and chemokine mediated signaling pathway; protein ubiquitination; negative regulation of protein kinase activity; defense response; JAK-STAT cascade; negative regulation of T cell activation; negative regulation of JAK-STAT cascade

Research Articles on SOCS6

Similar Products

Product Notes

The SOCS6 socs6 (Catalog #AAA6000600) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SOCS6 (Suppressor of Cytokine Signaling 6, SOCS-6, Cytokine-inducible SH2 Protein 4, CIS4, CIS-4, Suppressor of Cytokine Signaling 4, SOCS4, SOCS-4) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SOCS6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the SOCS6 socs6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKKISLKTLR KSFNLNKSKE ETDFMVVQQP SLASDFGKDD SLFGSCYGKD MASCDINGED EKGGKNRSKS ESLMGTLKRR LSAKQKSKGK AGTPSGSSAD EDTFSSSSAP IVFKDVRAQR PIRSTSLRSH HYSPAPWPLR PTNSEETCIK MEVRVKALVH SSSPSPALNG VRKDFHDLQS ETTCQEQANS LKSSASHNGD LHLHLDEHVP VVIGLMPQDY IQYTVPLDEG MYPLEGSRSY CLDSSSPMEV SAVPPQVGGR AFPEDESQVD QDLVVAPEIF VDQSVNGLLI GTTGVMLQSP RAGHDDVPPL SPLLPPMQNN QIQRNFSGLT GTEAHVAESM RCHLNFDPNS APGVARVYDS VQSSGPMVVT SLTEELKKLA KQGWYWGPIT RWEAEGKLAN VPDGSFLVRD SSDDRYLLSL SFRSHGKTLH TRIEHSNGRF SFYEQPDVEG HTSIVDLIEH SIRDSENGAF CYSRSRLPGS ATYPVRLTNP VSRFMQVRSL QYLCRFVIRQ YTRIDLIQKL PLPNKMKDYL QEKHY. It is sometimes possible for the material contained within the vial of "SOCS6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.