SDS-Page
(Baculovirus expressed SARS-CoV2 spike 318-542)
COVID 19 Spike RBD318-542 Coronavirus Recombinant Protein | COVID-19 recombinant protein
Covid-19 Spike-RBD318-542
Applications
ELISA, Lateral Flow, Western Blot
Purity
95% pure (10% SDS-PAGE Coomassie blue staining). Proprietary chromatographic technique.
Synonyms
COVID 19 Spike RBD318-542 Coronavirus; Covid-19 Spike-RBD318-542; 2019 Novel Coronavirus; Coronavirus; CoV; COVID-19 virus; HCoV-2; Human Coronavirus 2019; SARS2; SARS-CoV-2; Severe acute respiratory syndrome coronavirus 2; Spike RBD318-542; Receptor Binding Domain; COVID-19 recombinant protein
Host
Baculovirus
Purity/Purification
95% pure (10% SDS-PAGE Coomassie blue staining). Proprietary chromatographic technique.
Form/Format
Purified, Liquid
Concentration
1.0/ml (varies by lot)
Sequence
FVFLVLLPLVSSQCV RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNHHHHHH (Red color: SARS-CoV2 leader sequence)
Applicable Applications for COVID-19 recombinant protein
ELISA (EIA), Lateral Flow (LF), Immunoassay, Western Blow (WB)
Buffer
PBS with 0.025% NaN3 (or supply with the lyophilized protein as the customer request.)
Preparation and Storage
Short time in 4oC and long term in -20 degree C. avoid multiple freeze/thaw cycles.
SDS-Page
(Baculovirus expressed SARS-CoV2 spike 318-542)
SDS-Page
(Baculovirus expressed SARS-CoV2 spike 318-542)
Related Product Information for COVID-19 recombinant protein
SARS-CoV2 virus receptor binding domain (318 to 542) within S1 of Spike protein was cloned, expressed and purified from Baculovirus expression system. This protein contains SARS-CoV2 leader sequence and RBD 318-542 amino acids and a 6 x His tag at its C terminal, migrated about 83kDa forming trimer structure on SDS-PAGE, it was recognized by specific human IgG from Pfizer SARS-CoV2 RNA vaccinated blood and the recovery antibody from SARS-CoV2 infected patients on Western blot.
Like the real virus forming trimer structure, recombinant SARS-CoV2 RBD or spike protein may be present as monomer, dimer, or trimer. On our Western blot, our recombinant SARS-CoV2 RBD trimer showed the equal intensity on Western blot as RBD monomer from the outsource product.
Like the real virus forming trimer structure, recombinant SARS-CoV2 RBD or spike protein may be present as monomer, dimer, or trimer. On our Western blot, our recombinant SARS-CoV2 RBD trimer showed the equal intensity on Western blot as RBD monomer from the outsource product.
Similar Products
Product Notes
The COVID-19 (Catalog #AAA596331) is a Recombinant Protein produced from Baculovirus and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's COVID 19 Spike RBD318-542 Coronavirus can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Lateral Flow (LF), Immunoassay, Western Blow (WB). Researchers should empirically determine the suitability of the COVID-19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FVFLVLLP LVSSQCV RVQ PTESIVRFPN ITNLCPFGEV FNATRFASVY AWNRKRISNC VADYSVLYNS ASFSTFKCYG VSPTKLNDLC FTNVYADSFV IRGDEVRQIA PGQTGKIADY NYKLPDDFTC VIAWNSNNLD SKVGGNYNYL YRLFRKSNLK PFERDISTEI YQAGSTPCNG VEGFNCYFPL QSYGFQPTNG VGYQPYRVVV LSFELLHAPA TVCGPKKSTN LVKNKCVNFN HHHHHH (Red color: SARS-CoV2 leader sequence). It is sometimes possible for the material contained within the vial of "COVID 19 Spike RBD318-542 Coronavirus, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
