Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Corticosteroid Binding Globulin Recombinant Protein | CBG recombinant protein

Corticosteroid Binding Globulin Protein

Purity
>90% pure
Synonyms
Corticosteroid Binding Globulin; Corticosteroid Binding Globulin Protein; Purified recombinant Corticosteroid Binding Globulin Protein (GST tag); Serpin A6 protein; Transcortin protein; CBG protein; SERPINA6 protein; Corticosteroid-binding Globulin protein; CBG recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>90% pure
Form/Format
Supplied in PBS buffer, pH 7.4 with 50% Glycerol
Sequence Positions
23-405 with N terminal GST tag
Sequence
AA Sequence: MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFI SPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQG FQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYE SEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAI LVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQS STISYLHDAELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAAL SRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIA DLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGST GVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV
Sequence Length
406
Species
Human
Tag
GST tag
Preparation and Storage
Store at -20 degree c or -80 degree c for long term storage

SDS-Page

SDS-Page
Related Product Information for CBG recombinant protein
Corticosteroid Binding Globulin is a major transport protein for glucocorticoids and progestins in the blood of almost all vertebrate species.
Product Categories/Family for CBG recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
corticosteroid-binding globulin

Similar Products

Product Notes

The CBG (Catalog #AAA5316464) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-405 with N terminal GST tag. The amino acid sequence is listed below: AA Sequence: MDPNAAYVNM SNHHRGLASA NVDFAFSLYK HLVALSPKKN IFI SPVSISMALA MLSLGTCGHT RAQLLQGLGF NLTERSETEI HQG FQHLHQLFAK SDTSLEMTMG NALFLDGSLE LLESFSADIK HYYE SEVLAMNFQD WATASRQINS YVKNKTQGKI VDLFSGLDSP AI LVLVNYIFFK GTWTQPFDLA STREENFYVD ETTVVKVPMM LQS STISYLHDAE LPCQLVQMNY VGNGTVFFIL PDKGKMNTVI AAL SRDTINRWSA GLTSSQVDLY IPKVTISGVY DLGDVLEEMG IA DLFTNQANFS RITQDAQLKS SKVVHKAVLQ LNEEGVDTAG ST GVTLNLTSKP IILRFNQPFI IMIFDHFTWS SLFLARVMNP V. It is sometimes possible for the material contained within the vial of "Corticosteroid Binding Globulin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.