Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (IFN Alpha 7 antibody (MBS5303263) used at 1 ug/ml to detect target protein.)

Rabbit IFN Alpha 7 Polyclonal Antibody | anti-IFN Alpha 7 antibody

IFN Alpha 7 antibody

Gene Names
IFNA7; IFNA-J; IFN-alphaJ
Applications
Western Blot
Purity
Affinity purified
Synonyms
IFN Alpha 7; Polyclonal Antibody; IFN Alpha 7 antibody; Polyclonal IFN Alpha 7; Anti-IFN Alpha 7; Interferon Alpha 7; IFNA7; IFNA-J; anti-IFN Alpha 7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
IFN Alpha 7 antibody was raised against the N terminal of IFNA7
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IFNA7 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
189
Applicable Applications for anti-IFN Alpha 7 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
IFNA7 belongs to the alpha/beta interferon family. IFNA7 is produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Cross-Reactivity
Human
Immunogen
IFN Alpha 7 antibody was raised using the N terminal of IFNA7 corresponding to a region with amino acids RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(IFN Alpha 7 antibody (MBS5303263) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (IFN Alpha 7 antibody (MBS5303263) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-IFN Alpha 7 antibody
Rabbit polyclonal IFN Alpha 7 antibody raised against the N terminal of IFNA7
Product Categories/Family for anti-IFN Alpha 7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22 kDa (MW of target protein)
NCBI Official Full Name
interferon alpha-7
NCBI Official Synonym Full Names
interferon, alpha 7
NCBI Official Symbol
IFNA7
NCBI Official Synonym Symbols
IFNA-J; IFN-alphaJ
NCBI Protein Information
interferon alpha-7
UniProt Protein Name
Interferon alpha-7
UniProt Gene Name
IFNA7
UniProt Synonym Gene Names
IFN-alpha-7; LeIF J; IFN-alpha-J1
UniProt Entry Name
IFNA7_HUMAN

Uniprot Description

IFNA7: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Belongs to the alpha/beta interferon family.

Protein type: Membrane protein, integral; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 9p22

Cellular Component: extracellular space; extracellular region

Molecular Function: interferon-alpha/beta receptor binding; cytokine activity

Biological Process: B cell proliferation; adaptive immune response; response to virus; cytokine and chemokine mediated signaling pathway; regulation of MHC class I biosynthetic process; humoral immune response; T cell activation during immune response; response to exogenous dsRNA; cell-cell signaling; B cell differentiation; natural killer cell activation during immune response; innate immune response; blood coagulation; defense response to virus; positive regulation of peptidyl-serine phosphorylation of STAT protein

Research Articles on IFN Alpha 7

Similar Products

Product Notes

The IFN Alpha 7 ifna7 (Catalog #AAA5303263) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's IFN Alpha 7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the IFN Alpha 7 ifna7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IFN Alpha 7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.