Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HNRPUL1 antibody (MBS5303204) used at 1 ug/ml to detect target protein.)

Rabbit HNRPUL1 Polyclonal Antibody | anti-HNRPUL1 antibody

HNRPUL1 antibody

Gene Names
HNRNPUL1; E1BAP5; E1B-AP5; HNRPUL1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
HNRPUL1; Polyclonal Antibody; HNRPUL1 antibody; Polyclonal HNRPUL1; Anti-HNRPUL1; Heterogeneous Nuclear Ribonucleoprotein U-Like 1; FLJ12944; HNRPUL-1; HNRPUL 1; E1BAP5; E1B-AP5; anti-HNRPUL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
HNRPUL1 antibody was raised against the middle region of Hnrpul1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HNRPUL1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
767
Applicable Applications for anti-HNRPUL1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
HNRPUL1 is a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus E1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
HNRPUL1 antibody was raised using the middle region of Hnrpul1 corresponding to a region with amino acids LPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(HNRPUL1 antibody (MBS5303204) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (HNRPUL1 antibody (MBS5303204) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-HNRPUL1 antibody
Rabbit polyclonal HNRPUL1 antibody raised against the middle region of Hnrpul1
Product Categories/Family for anti-HNRPUL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
85 kDa (MW of target protein)
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein U-like protein 1 isoform e
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein U-like 1
NCBI Official Symbol
HNRNPUL1
NCBI Official Synonym Symbols
E1BAP5; E1B-AP5; HNRPUL1
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein U-like protein 1
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein U-like protein 1
UniProt Gene Name
HNRNPUL1
UniProt Synonym Gene Names
E1BAP5; HNRPUL1; E1B-AP5
UniProt Entry Name
HNRL1_HUMAN

NCBI Description

This gene encodes a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus E1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport, and its function is modulated by E1B-55kDa in adenovirus-infected cells. Two transcript variants encoding different isoforms have been found for this gene. Additional variants have also been found, but their full-length natures have not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

E1B-AP5: a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. Binds specifically to adenovirus E1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport, and its function is modulated by E1B-55kDa in adenovirus-infected cells. Four alternatively spliced isoforms have been described.

Protein type: RNA splicing; RNA-binding

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: nucleoplasm; ribonucleoprotein complex; nucleus

Molecular Function: protein binding; enzyme binding; RNA binding

Biological Process: nuclear mRNA splicing, via spliceosome; RNA processing; transcription, DNA-dependent; regulation of transcription, DNA-dependent; RNA splicing; response to virus; gene expression

Research Articles on HNRPUL1

Similar Products

Product Notes

The HNRPUL1 hnrnpul1 (Catalog #AAA5303204) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNRPUL1 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HNRPUL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the HNRPUL1 hnrnpul1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HNRPUL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.