Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (STRA13 antibody (MBS5302550) used at 1 ug/ml to detect target protein.)

Rabbit STRA13 Polyclonal Antibody | anti-STRA13 antibody

STRA13 antibody

Gene Names
STRA13; D9; MHF2; CENPX; CENP-X; FAAP10
Applications
Western Blot
Purity
Affinity purified
Synonyms
STRA13; Polyclonal Antibody; STRA13 antibody; Polyclonal STRA13; Anti-STRA13; STRA-13; Stimulated By Retinoic Acid 13 Homolog; STRA 13; MGC14480; E3; anti-STRA13 antibody
Ordering
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STRA13 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
57
Applicable Applications for anti-STRA13 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
STRA13 is a DNA-binding component of the FA core complex involved in DNA damage repair and genome maintenance.STRA13 is recruited to forks stalled by DNA interstrand cross-links, and required for cellular resistance to such lesions. As a component of the APITD1/CENPS complex,STRA13 is also essential for the stable assembly of the outer kinetchore.
Cross-Reactivity
Human
Immunogen
STRA13 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVD
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(STRA13 antibody (MBS5302550) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (STRA13 antibody (MBS5302550) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-STRA13 antibody
Rabbit polyclonal STRA13 antibody
Product Categories/Family for anti-STRA13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
7 kDa (MW of target protein)
NCBI Official Full Name
STRA13 protein, partial
NCBI Official Synonym Full Names
stimulated by retinoic acid 13
NCBI Official Symbol
STRA13
NCBI Official Synonym Symbols
D9; MHF2; CENPX; CENP-X; FAAP10
NCBI Protein Information
centromere protein X
UniProt Protein Name
Centromere protein X
Protein Family
UniProt Gene Name
STRA13
UniProt Synonym Gene Names
CENPX; FAAP10; MHF2; CENP-X
UniProt Entry Name
CENPX_HUMAN

Uniprot Description

STRA13: DNA-binding component of the FA core complex involved in DNA damage repair and genome maintenance. Recruited to forks stalled by DNA interstrand cross-links, and required for cellular resistance to such lesions. Component of the heterotetrameric CENP-T-W-S-X complex that binds and supercoils DNA, and plays an important role in kinetochore assembly. Component of the APITD1/CENPS complex that is essential for the stable assembly of the outer kinetochore. Plays an important role in mitotic progression and chromosome segregation. Belongs to the CENPX family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; DNA-binding

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: nucleoplasm

Molecular Function: protein binding; DNA binding; double-stranded DNA binding

Biological Process: mitosis; nucleosome assembly; kinetochore assembly; DNA replication-independent nucleosome assembly at centromere; positive regulation of protein ubiquitination; cell division; resolution of meiotic joint molecules as recombinants; DNA repair; replication fork processing

Research Articles on STRA13

Similar Products

Product Notes

The STRA13 stra13 (Catalog #AAA5302550) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's STRA13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the STRA13 stra13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STRA13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.