Western Blot (WB)
(Otospiralin antibody (MBS5300898) used at 1 ug/ml to detect target protein.)
Rabbit Otospiralin Polyclonal Antibody | anti-OTOS antibody
Otospiralin antibody
Gene Names
OTOS; OTOSP
Applications
Western Blot
Purity
Affinity purified
Synonyms
Otospiralin; Polyclonal Antibody; Otospiralin antibody; Polyclonal Otospiralin; Anti-Otospiralin; OTOSP; OTOS; anti-OTOS antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
Otospiralin antibody was raised against the N terminal of OTOS
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of OTOS antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
89
Applicable Applications for anti-OTOS antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
OTOS may be essential for the survival of the neurosensory epithelium of the inner ear.
Cross-Reactivity
Human
Immunogen
Otospiralin antibody was raised using the N terminal of OTOS corresponding to a region with amino acids MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNY
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(Otospiralin antibody (MBS5300898) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(Otospiralin antibody (MBS5300898) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-OTOS antibody
Rabbit polyclonal Otospiralin antibody raised against the N terminal of OTOS
Product Categories/Family for anti-OTOS antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
10 kDa (MW of target protein)
NCBI Official Full Name
otospiralin
NCBI Official Synonym Full Names
otospiralin
NCBI Official Symbol
OTOS
NCBI Official Synonym Symbols
OTOSP
NCBI Protein Information
otospiralin
UniProt Protein Name
Otospiralin
Protein Family
UniProt Gene Name
OTOS
UniProt Synonym Gene Names
OTOSP
UniProt Entry Name
OTOSP_HUMAN
NCBI Description
Otospiralin is synthesized by nonsensory cells (fibrocytes) of the inner ear, and downregulation of otospiralin in guinea pigs leads to deafness (Lavigne-Rebillard et al., 2003 [PubMed 12687421]).[supplied by OMIM, Mar 2008]
Uniprot Description
OTOS: May be essential for the survival of the neurosensory epithelium of the inner ear. Belongs to the otospiralin family.
Protein type: Secreted, signal peptide; Secreted
Chromosomal Location of Human Ortholog: 2q37.3
Cellular Component: extracellular region
Biological Process: sensory perception of sound
Research Articles on OTOS
Similar Products
Product Notes
The OTOS otos (Catalog #AAA5300898) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Otospiralin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the OTOS otos for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Otospiralin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
