Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SLC22A11 antibody (MBS5300697) used at 1.25 ug/ml to detect target protein.)

Rabbit SLC22A11 Polyclonal Antibody | anti-SLC22A11 antibody

SLC22A11 antibody

Gene Names
SLC22A11; OAT4; hOAT4
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
SLC22A11; Polyclonal Antibody; SLC22A11 antibody; Polyclonal SLC22A11; Anti-SLC22A11; OAT4; SLCA11-22; MGC34282; SLCA11 22; Solute Carrier Family 22 Member 11; hOAT4; Organic Anion/Urate Transporter 11; anti-SLC22A11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC22A11 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
442
Applicable Applications for anti-SLC22A11 antibody
Western Blot (WB)
Application Notes
WB: 1.25 ug/ml
Biological Significance
SLC22A11 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A11 is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus.
Cross-Reactivity
Human
Immunogen
SLC22A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCW
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(SLC22A11 antibody (MBS5300697) used at 1.25 ug/ml to detect target protein.)

Western Blot (WB) (SLC22A11 antibody (MBS5300697) used at 1.25 ug/ml to detect target protein.)
Related Product Information for anti-SLC22A11 antibody
Rabbit polyclonal SLC22A11 antibody
Product Categories/Family for anti-SLC22A11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60 kDa (MW of target protein)
NCBI Official Full Name
solute carrier family 22 member 11 isoform 2
NCBI Official Synonym Full Names
solute carrier family 22 (organic anion/urate transporter), member 11
NCBI Official Symbol
SLC22A11
NCBI Official Synonym Symbols
OAT4; hOAT4
NCBI Protein Information
solute carrier family 22 member 11
UniProt Protein Name
Solute carrier family 22 member 11
Protein Family
UniProt Gene Name
SLC22A11
UniProt Synonym Gene Names
OAT4
UniProt Entry Name
S22AB_HUMAN

NCBI Description

The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]

Uniprot Description

SLC22A11: Mediates saturable uptake of estrone sulfate, dehydroepiandrosterone sulfate and related compounds. Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell surface; Membrane protein, integral; Transporter; Membrane protein, multi-pass; Transporter, SLC family

Chromosomal Location of Human Ortholog: 11q13.1

Cellular Component: integral to plasma membrane; apical plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: protein binding; inorganic anion exchanger activity; organic anion transmembrane transporter activity; sodium-independent organic anion transmembrane transporter activity

Biological Process: urate metabolic process; transmembrane transport; organic anion transport

Research Articles on SLC22A11

Similar Products

Product Notes

The SLC22A11 slc22a11 (Catalog #AAA5300697) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SLC22A11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1.25 ug/ml. Researchers should empirically determine the suitability of the SLC22A11 slc22a11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC22A11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.