Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

APETx2 biochemical

APETx2

Purity
>=99.0% (HPLC)
Synonyms
APETx2; Gly-Thr-Ala-Cys-Ser-Cys-Gly-Asn-Ser-Lys-Gly-Ile-Tyr-Trp-Phe-Tyr-Arg-Pro-Ser-Cys-Pro-Thr-Asp-Arg-Gly-Tyr-Thr-Gly-Ser-Cys-Arg-Tyr-Phe-Leu-Gly-Thr-Cys-Cys-Thr-Pro-Ala-Asp; APETx2 biochemical
Ordering
For Research Use Only!
Purity/Purification
>=99.0% (HPLC)
Application Notes
Selective Blocker of Acid-Sensing Ion Channel, ASIC3
Source
Sea Anemone, Anthopleura elegantissima (Synthetic Product)
Disulfide Bonds
Reported Disulfide Bonds Between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38
Molecular Formula
C196H280N54O61S6
CAS Number
713544-47-9
One-Letter-Code
GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD
Preparation and Storage
Store at -20 degree C
Related Product Information for APETx2 biochemical
Selective Blocker of Acid-Sensing Ion Channel, ASIC3
A synthetic sea anenome toxin
Product Categories/Family for APETx2 biochemical
References
S. Diochot, A. Baron, L.D. Rash, E. Deval, P. Escoubas, S. Scarzello, M. Salinas, and M. Lazdunski, EMBO J., 23, 1516 (2004). (Original ; Primary Structure, S-S Bond & Pharmacol.) B. Chagot, P. Escoubas, S. Diochot, C. Bernard, M. Lazdunski, and H. Darbon, Protein Sci., 14, 2003 (2005). (NMR Structure) S. Diochot, M. Salinas, A. Baron, P. Escoubas, and M. Lazdunski, Toxicon, 49, 271 (2007). (Pharmacol.) E. Deval, J. Noel, N. Lay, A. Alloui, S. Diochot, V. Friend, M. Jodar, M. Lazdunski, and E. Lingueglia, EMBO J., 27, 3047 (2008). (Pharmacol.) J. Karczewski, R.H. Spencer, V.M. Garsky, A. Liang, M.D. Leitl, M.J. Cato, S.P. Cook, S. Kane and M.O. Urban, Br. J. Pharmacol., 16, 950 (2010). (Pharmacol.) E. Deval, J. Noel, X. Gasull, A. Delaunay, A. Alloui, V. Friend, A. Eschalier, M. Lazdunski, and E. Lingueglia, J. Neurosci., 31, 6059 (2011). (Pharmacol.) W.-L. Wu, C.-F. Cheng, W.-H. Sun, C.-W. Wong, and C.-C. Chen, Pharmacol. Ther., 134, 127 (2012). (Review; Pharmacol.)

Similar Products

Product Notes

The APETx2 (Catalog #AAA407593) is a Biochemical and is intended for research purposes only. The product is available for immediate purchase. Selective Blocker of Acid-Sensing Ion Channel, ASIC3. Researchers should empirically determine the suitability of the APETx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APETx2, Biochemical" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.