Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Big Endothelin-3 Active Protein

Big Endothelin-3 (Human, 1-41 Amide)

Synonyms
Big Endothelin-3; Big Endothelin-3 (Human; 1-41 Amide); Big ET-3 (human); Big Endothelin-3 (1-41); amide human; Big ET-3 (1-41) amide (human); H-Cys-Thr-Cys-Phe-Thr-Tyr-Lys-Asp-Lys-Glu-Cys-Val-Tyr-Tyr-Cys-His-Leu-Asp-Ile-Ile-Trp-Ile-Asn-Thr-Pro-Glu-Gln-Thr-Val-Pro-Tyr-Gly-Leu-Ser-Asn-Tyr-Arg-Gly-Ser-Phe-Arg-NH2; Big Endothelin-3 active protein
Ordering
For Research Use Only!
Molecular Formula
C223H322N56O63S4
Disulfide Bonds
Disulfide bonds between Cys1-Cys15 and Cys3-Cys11
One-Letter Code
H-CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH2
CAS Number
133551-97-0
Preparation and Storage
Store at -20 degree C
Product Categories/Family for Big Endothelin-3 active protein
References
T. Kosaka, N. Suzuki, Y. Ishibashi, H. Matsumoto, Y. Itoh, S. Ohkubo, K. Ogi, C. Kitada, H. Onda, and M. Fujino, J. Biochem., 116, 443 (1994). (Original; Biosynthesis)
M. Yanagisawa and T. Masaki, Trends Pharmacol. Sci., 10, 374 (1989). (Review)
T. Sakurai, M. Yanagisawa, and T. Masaki, Trends Pharmacol. Sci., 13, 103 (1992). (Review)
K.D. Bloch, R.L. Eddy, T.B. Shows, and T. Quertermous, J. Biol. Chem., 264, 18156 (1989). (Original; cDNA)

Similar Products

Product Notes

The Big Endothelin-3 (Catalog #AAA407532) is an Active Protein and is intended for research purposes only. The product is available for immediate purchase. It is sometimes possible for the material contained within the vial of "Big Endothelin-3, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.